KEGG   Streptococcus pneumoniae CGSP14 (serotype 14): SPCG_0059Help
Entry
SPCG_0059         CDS       T00690                                 

Gene name
strH
Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
spw  Streptococcus pneumoniae CGSP14 (serotype 14)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spw00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SPCG_0059 (strH)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SPCG_0059 (strH)
Enzymes [BR:spw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SPCG_0059 (strH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(60944..64969)
Genome map
AA seq 1341 aa AA seqDB search
MTLVNIRNKIKALIYIIAINITMQSGGFAMKHEKQQRFSIRKYAVGAASVLIGFAFQAQT
VAADGVTPTTTENQPTIHTVSDSPQSSENRTEETPKAELQPEAPKTVETETPATDKVASL
PKTEEKPQEEVSSTPSDKAEVVTPTSAEKETANKKAEEASPKKEEAKEVDSKESNTDKTD
KDKPAKKDEAKAEADKPETEAGKERAATVNEKLAKKKIVSIDAGRKYFSPEQLKEIIDKA
KHYGYTDLHLLVGNDGLRFMLDDMSITANGKTYASDDVKRAIEKGTNDYYDDPNGNHLTE
SQMTDLINYAKDKGIGLIPTVNSPGHMDAILNAMKELGIQNPNFSYFGKESARTVNLDNE
QAVAFTKALIDKYAAYFAKKTEIFNIGLDEYANDATDAKGWSVLQADKYYPNEGYPVKGY
EKFIAYANDLARIVKSHGLKPMAFNDGIYYNSDTSFGSFDKDIIVSMWTGGWGGYDVASS
KLLAEKGHQILNTNDAWYYVLGRNADGQGWYNLDQGLNGIKNTPITSVPKTEGADIPIIG
GMVAAWADTPSARYSPSRLFKLMRHFANANAEYFAADYESAEQALNEVPKDLNRYTAESV
TAVKEAEKAIRSLDSNLSRAQQDTIDQAIAKLQETVNNLTLTPEAQKEEEAKREVEKLAK
NKVISIDAGRKYFTLNQLKRIVDKASELGYSDVHLLLGNDGLRFLLNDMTITANGKTYAS
DDVKKAIIEGTKAYYDDPNGTALTQAEVTELIEYAKSKDIGLIPAINSPGHMDAMLVAME
KLGIKNPQAHFDKVSKTTMDLKNEEAMNFVKALIGKYMDFFAGKTKIFNFGTDEYANDAT
SAQGWYYLKWYQLYGKFAEYANTLAAMAKERELQPMAFNDGFYYEDKDDVQFDKDVLISY
WSKGWWGYNLASPQYLASKGYKFLNTNGDWYYILGQKPEDGGGFLKKAIENTGKTPFNQL
ASTKYPEVDLPTVGSMLSIWADRPSAEYKEEEIFELMTAFADHNKDYFRANYNALREELA
KIPTNLEGYSKESLEALDAAKTALNYNLNRNKQAELDTLVANLKAALQGLKPAATHSGSL
DENEVAANVETRPELITRTEEIPFEVIKKENPNLPAGQENIITAGVKGERTHYISVLTEN
GKTTETVLDSQVTKEVINQVVEVGAPVTHKGDESGLAPTTEVKPRLDIQKEEIPFTTVTR
ENPLLLKGKTQVITKGVNGHRSNFYSVSTSADGKEVKTLVNSVVAQEAVTQIVEVGTMVT
HVGDENGQAAIAEEKPKLEIPSQPAPSTAPAEESKALPQDPAPVVIEKKLPETGTHDSAG
LVVAGLMATLAAYGLTKRKED
NT seq 4026 nt NT seq  +upstreamnt  +downstreamnt
ttgactctcgttaatataagaaataaaataaaggcgttgatttatataatcgctatcaat
ataacaatgcaatcaggaggttttgcaatgaaacatgaaaaacaacagcgtttttctatt
cgtaaatacgctgtaggagcagcttctgttctaattggatttgccttccaagcacagact
gttgcagccgatggagttactcctactactacagaaaaccaaccgaccatccatacggtt
tctgattcccctcaatcatccgaaaatcggactgaggaaacacctaaagcagagcttcaa
ccagaagctccaaaaactgtagaaacagaaactccagctactgataaggtagctagtctt
ccaaaaacagaagaaaaaccacaagaggaagttagttcaactcctagtgataaagcagaa
gtggtaactccaacttctgctgaaaaagaaactgctaataaaaaggcagaagaagctagc
cctaaaaaggaagaagcgaaagaggttgattctaaagagtcaaatacagacaagactgac
aaggataaaccagctaaaaaagatgaagcgaaagcagaggctgacaaaccggaaacagag
gcaggaaaggaacgtgctgcaactgtaaatgaaaaactagcgaaaaagaaaattgtttct
attgatgctggacgtaaatatttctcaccagaacagctcaaggaaatcatcgataaagcg
aaacattatggctacactgatttacacctattagtcggaaatgatggactccgtttcatg
ttggacgatatgagcatcacagctaacggcaagacctatgccagtgacgatgtcaaacgc
gccattgaaaaaggtacaaatgattattacgacgatccaaacggcaatcacttaacagaa
agtcaaatgacagatctgattaactatgccaaagataaaggtatcggtctcattccgaca
gtaaatagtcctgggcacatggatgcgattctcaatgccatgaaagaattgggaatccaa
aaccctaactttagctattttgggaaggaatcagcccgtactgtcaatcttgacaacgaa
caagctgtcgcttttacaaaagcccttatcgacaagtatgctgcttatttcgcgaaaaag
actgaaatcttcaacatcggacttgatgaatatgccaatgatgcgacagatgctaaaggt
tggagtgtgcttcaagctgataaatactatccaaacgaaggctaccctgtaaaaggctat
gaaaaatttattgcctacgccaatgacctcgctcgtattgtaaaatcgcacggtctcaaa
ccaatggcctttaacgacggtatctactacaatagcgacacaagctttggtagttttgac
aaagacatcatcgtttctatgtggactggtggttggggaggctacgatgtcgcttcttct
aaactactagctgaaaaaggtcaccaaatccttaataccaatgatgcttggtactacgtt
cttggacgaaacgctgatggccaaggctggtacaatctcgatcaggggctcaatggtatt
aaaaacacaccaatcacttctgtaccaaaaacagaaggagctgatatcccaatcatcggt
ggtatggtagctgcttgggctgacactccatctgcacgttattcaccatcacgcctcttc
aaactcatgcgtcattttgcaaatgccaacgctgaatacttcgcagctgattatgaatct
gcagagcaagcacttaacgaggtaccaaaagacctgaaccgttatactgcagaaagcgtc
acggccgtaaaagaagctgaaaaagctattcgctctctcgatagcaaccttagccgtgcc
caacaagatacgattgatcaagccattgctaaacttcaagaaactgtcaacaacttgacc
ctcacgcctgaagctcaaaaagaagaagaagctaaacgtgaggttgaaaaacttgccaaa
aacaaggtaatctcaatcgatgctggacgcaaatactttactctgaaccagctcaaacgc
atcgtagacaaggccagtgagctcggatattctgatgtccatctccttctaggaaatgac
ggacttcgctttctactcaatgatatgaccattactgccaacggaaaaacctatgctagt
gatgacgttaaaaaagctattatcgaaggaactaaagcttactacgacgatccaaacggt
actgcactaacacaggcagaagtgacagagctaattgaatacgctaaatctaaggacatc
ggtctcatcccagctattaacagtccaggtcacatggatgctatgctggttgccatggaa
aaattaggtattaaaaatcctcaagcccactttgataaagtttcaaaaacaactatggac
ttgaaaaacgaagaagcgatgaactttgtaaaagccctcatcggtaaatacatggacttc
tttgcaggtaaaacaaagattttcaactttggtactgacgaatacgccaacgatgcgact
agtgcccaaggctggtactacctcaagtggtatcaactctatggcaaatttgccgaatat
gccaacaccctcgcagctatggccaaagaaagagagcttcaaccaatggccttcaacgat
ggcttctactatgaagacaaggacgatgttcagtttgacaaagatgtcttgatttcttac
tggtctaaaggctggtggggatataacctcgcatcacctcaatacctagcaagcaaaggc
tataaattcttgaataccaacggtgactggtactacattcttggtcaaaaaccagaagat
ggtggtggtttcctcaagaaagctattgagaatactggaaaaacaccattcaatcaacta
gcttctaccaaatatcctgaagtagatcttccaacagtcggaagtatgctttcaatctgg
gcagatagaccaagcgctgaatacaaggaagaggaaatctttgaactcatgactgccttt
gcagaccacaacaaagactacttccgtgctaattataatgctctccgcgaagaattagct
aaaattcctacaaacttagaaggatatagtaaagaaagtcttgaggcccttgacgcagct
aaaacagctctaaattacaacctcaaccgtaataaacaagctgagcttgacacacttgta
gccaacctaaaagccgctcttcaaggcctcaaaccagctgcaactcattcaggaagcctg
gatgaaaatgaagtggctgccaatgttgaaaccagaccagaactcatcacaagaactgaa
gaaattccatttgaagttatcaagaaagaaaatcctaacctcccagctggtcaggaaaat
attatcacagcaggagtcaaaggtgagcgaactcattacatctctgtactcactgaaaat
ggaaaaacaacagaaacagtccttgatagccaggtaaccaaagaagttataaaccaagtg
gttgaagttggcgctcctgtaactcacaagggtgatgaaagtggtcttgcaccaactact
gaggtaaaacctagactggatatccaaaaagaagaaattccatttaccacagtgactcgt
gaaaatccactcttactcaaaggaaaaacacaagtcattactaagggcgtcaatggacat
cgtagcaacttctactctgtgagcacttctgccgatggtaaggaagtgaaaacacttgta
aatagtgtcgtagcacaggaagccgttactcaaatagtcgaagtcggaactatggtaaca
catgtaggcgatgaaaacggacaagccgctattgctgaagaaaaaccaaaactagaaatc
ccaagccaaccagctccatcaactgctcctgctgaggaaagcaaagctcttcctcaagat
ccagctcctgtggtaatagagaaaaaacttcctgaaacaggaactcacgattctgcagga
ctagtagtcgcaggactcatggccacactagcagcctatggactcactaaaagaaaagaa
gactaa

DBGET integrated database retrieval system