KEGG   Streptococcus pneumoniae CGSP14 (serotype 14): SPCG_0140Help
Entry
SPCG_0140         CDS       T00690                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
spw  Streptococcus pneumoniae CGSP14 (serotype 14)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:spw00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
139099..140637
Genome map
AA seq 512 aa AA seqDB search
MENTLLNITGSFDMETRNLISYSLTDIFETDKIRIELLGEIYYKNIKLELHEFAGLYKIY
GISLIKNITGMFLIIIFDTKTKELKIFQDITTSYFNLYYTVYGGVFYYSTSLKKVMKLSH
VPVTLNNKKIQEFMRNGFILDSNTLVTEINKLEYFSYISVNNTLRICGIDYNDSNNFTKE
QVLKNWDSMLRESILRVYSEAGEANITLSSGFDSNYILYTLANYTNSSINAFCIGGEKGI
NEIPEVTKIAKFYGINLLVDTVMSQDLEYFPDIVWRLEGSLFECGVILQYYLGRLLFQKG
NTSILCGESADEIMTFKYHSVNYNQFCNDKQKSVYFSYSDYPFYVTNSIVLKKNSLLLHS
FGIHPRYPYKMSEIVEMSKKISDLNDKKEFHKKNCELRFQDSVLDNINSVPGTTHLFSCL
NIQTLVKIILYIFRYNSCMKIFNFRDKELIFFNKIVNGLIQNIEENLEDDIERILKYLYI
CLFNEIFIIKNKVNFFDDVEFNQTLSEFLDKL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatactttattgaatatcacaggaagcttcgatatggaaactaggaatctaatt
agttattctttaactgatatctttgaaacagataaaataagaattgaacttcttggagaa
atttattataaaaatataaagttggaattgcatgaattcgctggattgtataagatttat
ggaattagcttaataaagaatattaccggaatgtttttaattataatttttgatacgaag
acaaaagaattaaaaatttttcaagatataacgacttcatactttaatttatactatact
gtttatggaggtgtgttctattatagtacatctttaaagaaagtgatgaagttatctcat
gttcccgttaccttaaataacaaaaaaatacaagaatttatgagaaatggatttatttta
gattcaaatactttagtaaccgaaattaataaattagaatatttctcttacatttctgta
aataatactcttcgtatatgtggtattgattataatgattcaaacaattttactaaagaa
caagtattaaagaattgggactctatgctacgtgaatctatattaagagtgtatagtgaa
gcaggagaggctaatattacactatcatctggttttgattcaaattatatattatataca
ttagcgaattatacgaattcttcaattaatgcattttgcataggaggagaaaaaggaatt
aatgagattcctgaagtaactaaaattgcaaaattttatggtataaatttattagttgat
actgtaatgagccaagatttagaatattttcccgatatagtatggagattggaaggaagt
ctctttgaatgtggtgtcatactgcagtactatttaggcaggttgttgttccaaaaaggg
aacacaagtattctttgtggcgagtcagcggatgaaataatgacttttaagtatcattct
gtgaactacaatcaattttgtaatgataaacagaagtcagtatattttagttattccgac
tatccattttatgttacaaattcaattgttttaaagaaaaatagcctacttttgcatagt
tttggcattcatcctagatatccatataaaatgtctgagattgttgaaatgtctaaaaaa
atatcagatctaaacgataaaaaagaatttcacaaaaagaactgtgagttgaggtttcaa
gatagtgttcttgataacataaatagtgtcccgggtacaactcatttatttagttgttta
aatattcaaacattagtaaaaattattttatatatttttcgatacaacagttgtatgaaa
atatttaattttagagataaagagcttatcttttttaataagattgtaaatgggctgata
caaaatattgaggagaatttagaggatgatattgaaaggatattgaaatatttatatata
tgtttatttaacgaaatattcattattaagaataaggtgaatttttttgatgatgtggaa
tttaatcagacacttagtgaatttttagataaattgtag

DBGET integrated database retrieval system