KEGG   Streptococcus pneumoniae CGSP14 (serotype 14): SPCG_0154Help
Entry
SPCG_0154         CDS       T00690                                 

Definition
hypothetical protein
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
spw  Streptococcus pneumoniae CGSP14 (serotype 14)
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:spw00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SPCG_0154
  Amino acid metabolism
   00300 Lysine biosynthesis
    SPCG_0154
Enzymes [BR:spw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SPCG_0154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
155596..156969
Genome map
AA seq 457 aa AA seqDB search
MVFPSEQEQIEKFEKDHVAQHYFEVLRTLISKKSVFAQQVGLKEVANYLGEIFKRVGAEV
EIDETYTAPFVMAHFKSSRPDAKTLIFYNHYDTVPADGDQVWTEDPFTLSVRNGFMYGRG
VDDDKGHITARLSALRKYMQHHDDLPVNISFIMEGAEESASTDLDKYLEKHADKLRGADL
LVWEQGTKNALEQLEISGGNKGIVTFDAKVKSADVDIHSSYGGVVESAPWYLLQALQSLR
AADGRILVEGLYEEVQEPNEREMALLETYGQRNPEEVSRIYGLELPLLQEERMAFLKRFF
FEPALNIEGIQSGYQGQGVKTILPAEASAKLEVRLVPGLEPHDVLEKIRKQLDKNGFDKV
ELYYTLGEMSYRSDMSAPAILNVIELAKKFYPQGVSVLPTTAGTGPMHTVFDALEVPMVA
FGLGNANSRDHGGDENVRIADYYTHIELVEELIRSYE
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggtttttcctagcgaacaagaacagattgaaaaatttgaaaaggatcatgtagcccag
cattattttgaggttttgcgtaccttaatttctaagaaatcagtctttgcccagcaggtg
ggtctcaaagaagttgccaactatctgggtgagattttcaagcgtgttggggctgaagtg
gagattgatgagacttacacggcgccttttgtcatggcgcatttcaagagttcgcgtcca
gatgccaagaccttgattttctataaccactatgacactgtgccagcggatggggatcag
gtctggacagaggatccctttacgctttcggtgcgcaatggcttcatgtatgggcgtggg
gttgacgatgataagggtcatatcacagctcgtttgagtgctttgagaaaatatatgcag
caccacgatgacctgcctgtcaatatcagttttatcatggagggagcggaggaatcggct
tcgacagacctagataagtatctggaaaaacatgcggataaactccgtggggcggatttg
ttggtctgggaacaagggaccaaaaatgccttggaacagctagaaatttctggtggcaat
aaggggattgtgacctttgatgccaaggtgaaaagtgctgatgtcgatatccactctagt
tatggtggggttgtggaatcagctccttggtatctcctccaagccttacagtctcttcgc
gctgcagatggccgtatcttggttgaaggcttgtacgaagaagtgcaagagccaaatgaa
cgagaaatggccttgctagaaacttatggtcaacgaaacccagaggaagttagtcggatt
tatggattggagttgcctctcttacaggaagagcggatggcctttctaaaacgtttcttt
ttcgagccagcgcttaatatcgaagggattcagtctggttatcaaggtcagggtgttaag
actattttgcctgcagaagccagtgccaagctagaggttcgtctggttccgggcctagaa
ccgcatgatgttctggaaaaaattcggaaacagctagacaaaaatggctttgataaggta
gaattatactataccttgggagagatgagctatcgaagcgatatgagcgcaccagccatt
ctcaatgtaatcgagttggctaagaaattctatccacagggcgtttcagtcttgccgact
acagctgggacagggcctatgcatacggtctttgatgccctagaggtgccaatggtggcc
ttcggtctaggaaatgccaatagccgagaccacggtggagatgaaaatgtgcgaatcgcc
gattattacacccatattgaattagtagaggagctgattagaagctatgagtag

DBGET integrated database retrieval system