KEGG   Streptococcus pneumoniae CGSP14 (serotype 14): SPCG_0302Help
Entry
SPCG_0302         CDS       T00690                                 

Gene name
sulA
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
spw  Streptococcus pneumoniae CGSP14 (serotype 14)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SPCG_0302 (sulA)
Enzymes [BR:spw01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SPCG_0302 (sulA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
293028..294008
Genome map
AA seq 326 aa AA seqDB search
MMKSLEGVTDMSSKANHAKTAICGIINVTPDSFSDGGQFFALEQALQQARKLIAEGASML
DIGGESTRPRPGSSYVEIEEEIQRVVPVIKAIRKESDVLISIDTWKSQVAEAALAAGANL
VNDITGLMGDEKMAHEVAKAGAKVVIMFNPVMARPQHPSSLIFPHFGFGQAFTEKELADF
EKLPIEELMETFFERALARAEEAGIAQENILLDSGIGFGLTKKENLLLLRDLDKLHQKGY
PIFLGVSRKRFVINILEENGFEVNPETELGFRNRDTASAHVTSIAARQGVDVVRVHDVAS
HRMAVEIASAIRLADEAENLDLKQYK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaagtcttgagggagtgaccgatatgtcaagtaaagccaatcatgcaaagaca
gctatttgcggaattatcaatgtaaccccagactccttttcggacggtggtcaatttttt
gctcttgagcaggcactccagcaggctcgtaaattgatagcagaaggggctagtatgctc
gatatcggcggagaatcgactcggccgcggccgggaagtagttatgttgagatagaagag
gaaatccagcgtgttgttccagtgatcaaagctattcgcaaggaaagtgatgtcctcatc
tctattgatacttggaagagtcaagtagcagaagctgctttggctgctggtgccaatcta
gtcaatgatatcactggtcttatgggtgatgagaaaatggcccatgaggttgctaaggct
ggtgcgaaagtagtcattatgtttaatccagtcatggcacgacctcagcaccctagctcg
ctcatcttccctcattttggctttggtcaagcttttacagaaaaagagttagctgacttt
gaaaaattgccaatcgaagagttgatggagactttttttgaacgagcactagcgagagca
gaggaagctgggattgctcaagaaaacatcctgctggattcaggaattggctttggtctg
accaagaaagaaaatctgcttcttttacgggatctggataaactacatcagaaaggctat
ccaatctttctcggagtgtcgcgcaagcggtttgtcatcaatatccttgaagaaaatggt
tttgaagtcaatcctgagacagaacttggtttccgcaatcgggatacggcttcggctcat
gtaactagtatcgctgcgagacagggtgtagacgtggtgcgcgtgcatgacgtagcaagt
cacaggatggcagttgaaattgcctctgccattcgtctggctgatgaagcggaaaattta
gatttaaaacaatataaataa

DBGET integrated database retrieval system