KEGG   Streptococcus pneumoniae CGSP14 (serotype 14): SPCG_0305Help
Entry
SPCG_0305         CDS       T00690                                 

Gene name
sulD
Definition
bifunctional folate synthesis protein
Orthology
K13940  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:4.1.2.25 2.7.6.3]
Organism
spw  Streptococcus pneumoniae CGSP14 (serotype 14)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:spw00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
295910..296722
Genome map
AA seq 270 aa AA seqDB search
MDQLQIKDLEMFAYHGLFPSEKELGQKFVVSAILSYDMTKAATDLDLTASVHYGELCQQW
TTWFQETSEDLIETVAYKLVERTFESYPLVQEMKLELKKPWAPVHLSLDTCSVTIHRRKQ
RAFIALGSNMGDKQANLKQAIDKLRARGIYILKESSVLATEPWGGVEQDSFANQVVEVET
WLPAQDLLETLLAIESELGRVREVHWGPRLIDLDLLFVEDQILYTDDLILPHPYIAERLF
VLESLQEIAPHFIHPILKQPIRNLYDALKK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggatcaactgcagattaaggatttggaaatgtttgcctatcatggtctttttcctagt
gagaaagaattggggcagaaatttgtcgtttcagccatcctatcctatgatatgaccaag
gcagctacagacttggatttaacagcctctgtccattacggagaattgtgtcagcagtgg
acgacttggtttcaggaaacgagtgaagatttgattgaaacggtagcctataaactggtg
gaacgtacctttgagtcttatcctcttgtccaagaaatgaagttggaactgaaaaaacct
tgggcaccggtgcatttgtcactagatacttgctcggtaaccatccatcgccgcaagcaa
cgagcctttatcgccctaggaagcaatatgggagataaacaagcaaacttgaagcaagcc
attgacaaactgcgagctcgtggcatctatattctcaaagagtccagtgtcttagcgacg
gagccttggggtggagtggagcaggatagctttgccaatcaagtggttgaggtggaaacc
tggctaccagcacaagacttgttagaaaccttgttagccattgagtcagagctgggacgg
gtgagagaagtgcattggggacctcgtttgattgatttggacttgctctttgtggaggac
cagatcctttatacagacgacctcatattgcctcatccttacatagcggaacgccttttt
gtccttgagtccttacaggaaattgcgcctcattttatccatccgatattaaaacaaccg
atccgtaacttgtatgatgctttgaaaaaatag

DBGET integrated database retrieval system