KEGG   Streptococcus pneumoniae CGSP14 (serotype 14): SPCG_0312Help
Entry
SPCG_0312         CDS       T00690                                 

Gene name
celA
Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
spw  Streptococcus pneumoniae CGSP14 (serotype 14)
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:spw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPCG_0312 (celA)
Enzymes [BR:spw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SPCG_0312 (celA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
299499..300977
Genome map
AA seq 492 aa AA seqDB search
MRFIIRVSKSGGKKMTTFKDRFLWGGAVAAHQLEGGWQEGGKGISVADVMTAGRHGVARE
ITSGVLEGKYYPNHEAIDFYHRYKEDIALFAEMGFKCFRTSIAWTRIFPKGDELEPNEEG
LQFYDNLFDECLKNGIEPVITLSHFEMPYHLVTEYGGWKNRKLIDFFARFAEVVFKRYKD
KVKYWMTFNEINNQANYQEDFAPFTNSGIVYEEGDNREAIMYQAAHYELVASARAVKIGH
EINPDFQIGCMIAMCPIYPATCNPKDILMAMKAMQKRYYFADVHVLGKYPEHIFKYWERK
GISVDFTAQDKEDLLGGTVDYIGFSYYMSFAIDSHRENNPYFDYLETEDLVKNNYVKASE
WEWQIDPEGLRCALNWFTDHYHLPLFIVENGFGAIDQVAADGMVHDDYRIEYLGAHIREM
KKTVVEDGVDLMGYTPWGCIDLVSAGTGEMRKRYGFIYVDKDDNGKGSYNRSPKKSFGWY
KEVISSNGESVE
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
ttgaggtttataataagagtatcaaagtcaggaggaaaaaagatgactacttttaaagat
agatttttatggggtggtgctgttgctgctcatcaacttgaaggcggatggcaagaaggt
ggcaaaggaattagtgttgctgatgttatgactgctggtcgtcatggagtagctcgtgaa
attacttcgggagttttagagggtaaatattatccaaatcatgaggcgatagatttttat
catcgttataaagaagacatagcactttttgctgaaatgggattcaagtgcttccgtacc
tctattgcatggacacgtatttttccaaaaggtgatgagttagagccgaatgaagaagga
ttacagttttatgataatctttttgatgaatgcttaaagaatggtattgaacctgtcatc
actctatctcattttgaaatgccttatcacttagtgaccgaatatggtggttggaaaaat
aggaaattgattgatttctttgctcgttttgcagaagtcgtatttaaacgttacaaagat
aaggttaaatattggatgactttcaatgaaatcaataatcaagcgaattatcaggaagat
tttgcaccatttactaactcaggtattgtatatgaggaaggtgataatagagaggcaatt
atgtatcaagcagcacattacgaattagttgcttctgcacgagctgtaaaaattggtcat
gagattaatccagattttcaaataggttgtatgattgcgatgtgtccaatttatccagct
acttgcaatcctaaggatatcttaatggcaatgaaagctatgcaaaagcgttattatttt
gctgatgtgcatgttttaggtaaatatcctgagcatattttcaagtattgggaacgaaaa
ggtatttcagttgattttactgcccaggataaagaagatttacttggtgggactgtagat
tacattggtttcagttactatatgtcctttgctatcgactctcatcgtgaaaataatcct
tattttgattatcttgaaacagaagatttagtgaaaaataattatgttaaggcttctgaa
tgggagtggcaaattgatccagaaggtttacgttgtgcgttaaattggtttacagaccac
tatcacttaccactctttattgttgaaaatggttttggagctatagatcaagttgcagca
gatggtatggtacatgatgattatagaattgaatatctaggtgcccatattcgtgaaatg
aaaaagactgtagttgaagatggtgttgatttaatgggctatactccatggggatgtatt
gatttggtttcagctggtaccggtgaaatgcggaaacgttatggctttatttatgtagat
aaagatgacaatgggaagggaagttataatcgttccccgaaaaaatcttttggctggtat
aaggaagttatttcatctaacggtgaatcagtggaatag

DBGET integrated database retrieval system