KEGG   Streptococcus pneumoniae CGSP14 (serotype 14): SPCG_0321Help
Entry
SPCG_0321         CDS       T00690                                 

Gene name
basA
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
spw  Streptococcus pneumoniae CGSP14 (serotype 14)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:spw00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SPCG_0321 (basA)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SPCG_0321 (basA)
Enzymes [BR:spw01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SPCG_0321 (basA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(309490..309966)
Genome map
AA seq 158 aa AA seqDB search
MTSLYDFSVLNQNNQATPLDSYRGKVLLIVNTATGCGLTPQYQGLQELYERYQDQGFEIL
DFPCNQFMGQAPGSAEEINTFCSLHFQTTFPRFAKIKVNGKEADPLYVWLKDHKSGPLGK
RVEWNFAKFLIGRDGQVFERFSSKTDPKQIEEAIQTLL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgacttcactttatgatttttccgttttgaaccaaaacaaccaagcaactcccttggat
agctatcgtggcaaagttctcttgattgtcaacactgctactggatgtggtttaacgccc
cagtaccagggacttcaagaactctatgaacgctatcaagatcagggcttcgaaatattg
gatttcccttgcaatcagtttatgggacaagcacccggcagcgcagaggaaatcaacacc
ttctgtagcctacattttcaaaccaccttcccacgttttgccaagattaaggtcaacggt
aaggaagcagaccctctctatgtctggttaaaagaccataaatccggcccactaggaaaa
cgagtcgaatggaatttcgctaagtttctcatcggtcgagatgggcaagtctttgaacgc
ttttcttcaaaaacagacccaaaacaaattgaagaggcgatacaaactctactataa

DBGET integrated database retrieval system