KEGG   Streptococcus pneumoniae CGSP14 (serotype 14): SPCG_0400Help
Entry
SPCG_0400         CDS       T00690                                 

Gene name
recD
Definition
helicase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
spw  Streptococcus pneumoniae CGSP14 (serotype 14)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:spw00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SPCG_0400 (recD)
Enzymes [BR:spw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SPCG_0400 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(395047..397413)
Genome map
AA seq 788 aa AA seqDB search
MEVYFSGTIERIIFENPSNFYRILLLEIDDTDAEDFDDFEIIVTGTMADVIEGEDYTFWG
QIVQHSKYGEQLQISRYDRTKPTSKGLVKYFSSSHFKGIGLKTAQKIVDTYGENTIDEIL
QHPEKLEGIAGLSAKNREAFVSTLRLNYGTEMVLAKLANYGIPNKLAFQIQDFYKEETLD
VVENYPYQLVEDIKGLGFTIADQLAEELGIESQAPERFRAGLVHSLFQACMETGDTYVEA
RDLLEQTLTLLESSRPVELDPSQVAQELSYLIEEDKVQQIDTKIFDNSLFFAEEGIRSHL
VRILEKGKQKSHDLETIQKHITTVEQELGIEYDNIQKQAICDAIQNKVFILTGGPGTGKT
TVINGIIAVYALLEGLDFRKKSNLPILLAAPTGRAARRMNELTGLPSATIHRHLGMTGDD
DTSHLEDYLDADFIIVDEFSMVDTWLANQLFSNISSNSKILIVGDSDQLPSVSPGQVLAD
LLHIPLIPQTRLEKIYRQSKESTIVTLASQIRQGILPADFTQKKADRSYFEIASGHIPAT
IEKILGAALRNGIPARDIQVLAPMYRGTAGIDAINQLMQDLLNPPQKDQLSFEAPQCHYR
KGDKVIHLVNDAEINVFNGDLGAITDLIPGKYTESKQDEIVIDFDGNEVSYPRNEWYKIR
LAYAMSIHKSQGSEFPVVILPITSASRRMLERNLIYTAITRAKSKLILLGELQAFDYATQ
HIGTARKTYLIERFSDLLENVEEKQQAVSETVTSSASEQSYILTEENWDSIPAMIGITDT
DLKEIFGK
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atggaagtttatttttcaggaaccattgaacggattatttttgaaaatcccagcaatttt
tatcgcatcctcctcctagaaatagacgatacggacgcagaggattttgatgattttgaa
atcattgtcacaggaaccatggctgatgtaattgagggcgaagactatactttttggggg
caaattgtccagcactccaagtatggagaacaactgcaaatcagtcgttatgatcgcaca
aaaccaactagtaagggattggtcaagtacttttcaagtagccatttcaaggggattggt
ctcaagacagctcagaaaatcgtagatacctatggcgaaaataccattgatgaaattttg
caacacccagaaaagttagaaggcatcgcaggactctctgccaaaaatcgcgaggctttc
gtctccactctccgtctcaactacggaacggagatggttttggccaaactagccaactac
ggcattcccaacaaactagcctttcagattcaagacttttacaaggaagaaacccttgat
gtggttgaaaattatccctaccagctggttgaggatatcaagggtttgggctttaccatt
gctgaccaactagctgaggaactaggcatcgaaagtcaggctcctgaacgcttccgcgcc
ggtctagttcacagtctttttcaggcctgtatggaaacaggggacacctatgttgaagca
cgggatttgctggaacaaacccttactctccttgagtcttcccgtcccgtggaactagac
cccagccaagttgcccaagagctctcctacctgatcgaagaagacaaggttcagcagatt
gataccaagatctttgacaacagcctctttttcgctgaggaaggcatccgcagtcacttg
gttcgtatccttgaaaaaggaaaacagaagagtcatgatttagaaaccattcaaaaacat
atcactactgtcgagcaagaactgggaattgagtatgataacattcaaaaacaggctatc
tgtgatgctatccagaataaggtctttatcctgacaggtgggcctggtactggtaagaca
actgttatcaatggaatcattgctgtttatgcccttttagaaggacttgacttcaggaag
aaaagcaatctgcccattcttcttgctgctccaactggtcgagctgctcgtcgcatgaat
gaattgacaggtttgcctagcgcgaccatacatcgccacttgggaatgacaggtgacgat
gataccagtcatctggaagattacctagatgctgactttatcatcgtggatgaattctct
atggtagatacttggctggccaatcaactcttctccaatatctcttctaacagtaagatc
ctcatcgtaggtgacagtgatcagctaccttctgtcagtcctggacaggttctagcggat
ctacttcatattcctttgattcctcagactcgcttggaaaaaatttatcgacaaagcaaa
gaatcaaccatcgtcaccctagctagtcagattcgacagggcatcttgccagctgatttc
acccaaaaaaaagctgaccgttcctactttgaaattgctagtggccatattcctgccacc
attgaaaaaatcttaggtgccgccctcagaaatggtattcctgcccgtgatatccaagtt
ctggctcctatgtaccgagggacggcagggattgatgctatcaatcagctcatgcaagac
ctgctcaatcccccacaaaaagatcaactcagttttgaagctcctcagtgccactatcgt
aagggagacaaggtcattcatttggttaacgatgctgaaatcaatgtctttaatggggat
ttaggagctatcacagacctgattcctggtaaatacaccgaatcgaaacaagacgagatt
gtcattgattttgatggtaatgaagtctcttacccccgtaacgaatggtacaagattcgc
ttggcctatgccatgagtattcataagtctcagggaagtgagttcccagttgtcatccta
ccgattactagtgctagccgacgtatgctggagcgaaatctcatctacacagccattaca
cgtgccaaaagcaaactcatcttactaggcgaattacaagccttcgactatgctacccaa
cacatcggaactgcccgaaaaacctatctgattgaacgcttcagtgatctactggagaat
gttgaagaaaagcaacaagctgtctctgaaacagtcacatcaagtgcctctgaacaatcc
tacatcctaaccgaagaaaactgggacagcattccagccatgattgggattacagacaca
gacctcaaagagatttttggaaaatag

DBGET integrated database retrieval system