KEGG   Streptococcus pneumoniae CGSP14 (serotype 14): SPCG_0544Help
Entry
SPCG_0544         CDS       T00690                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
spw  Streptococcus pneumoniae CGSP14 (serotype 14)
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:spw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPCG_0544
Enzymes [BR:spw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SPCG_0544
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
535770..537185
Genome map
AA seq 471 aa AA seqDB search
MTIFPDDFLWGGAVAANQVEGAYNEDGKGLSVQDVLPKGGLGEATENPTEDNLKLLGIDF
YHKYKEDITLFSEMGFNVFRTSIAWSRIFPKGDEEEPNEAGLKYYDELFDELHAHGIEPL
VTLSHYETPLYLARKYHGWIDRRMIHFYEKFARTVLERYKDKVKYWLTFNEVNSVLELPF
TSGGIDIPKENLSKQELYQAIHHELVASSLVTKIAREINSEFKVGCMVLAMPAYPMTPNP
KDVWATHEYENLNYLFSDVHVRGYYPNYAKRYFKEHDINIEFAAEDAELLKNYTVDFLSF
SYYMSVTQSALPTQYNSGEGNIIGGLVNPYLESSEWGWQIDPIGLRIILNRYYDRYQIPL
FIVENGLGAKDQLIKDEFNNLTVQDDYRIQYMKEHLLQVAEALQDGVEIMGYTSWGCIDC
VSMSTAQLSKRYGLIYVDRNDDGNGTFNRYKKMSFTWYKGVIESNGESLFK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgaccatttttccagatgattttctttggggtggagctgttgcagctaatcaagtagag
ggagcatataatgaagatggtaagggcttatcagttcaggatgtgttacccaaaggtgga
ttaggagaagcaacagaaaatcctacagaagataacttaaaattattaggtattgatttt
tatcataaatataaggaagatataaccttgttttctgaaatgggctttaatgtttttcgt
acttctattgcatggagtagaatttttccaaaaggagatgaagaagaacctaacgaagct
ggtttgaaatattatgatgaattgtttgatgaactacatgctcacgggatagagccactt
gtaactctttcacactatgagactccattatatttagcaagaaaatatcatggatggatt
gataggagaatgattcatttttatgaaaaatttgctcgaacagttttagaaaggtataaa
gataaagttaaatattggcttacatttaacgaagtaaactctgttttggaattaccgttt
actagtggaggaatagatatacctaaggagaatctttcgaaacaagaattatatcaagct
atacatcatgaattagtcgcctcgagtttggttacaaaaattgctcgtgagattaattca
gagtttaaggtggggtgtatggtattagctatgccagcttatccaatgactccaaatcca
aaagatgtatgggcgactcatgagtatgagaatctaaattatctattttcagatgtgcat
gttagaggttattatccgaattatgcaaaaagatattttaaggaacatgacattaacata
gagtttgcagctgaagatgcagagttattaaaaaattatactgtagattttttatccttt
agctattacatgagtgtgactcaatctgctcttccaacacagtataattcaggagaaggg
aatattattggtggtttagtaaatccttatttagagtcttctgagtggggatggcaaatt
gatccaattggactacgtataattttaaatagatattatgaccgttatcaaattccatta
tttatagtggaaaacggattaggtgctaaagatcaactaataaaagatgaatttaataac
ttaaccgtccaagatgattatagaattcagtatatgaaagaacatttattgcaagtagct
gaagctctacaagatggtgtggaaattatgggctatacgtcttggggatgtattgactgc
gtttctatgtccactgcacagctttctaagaggtacggtctcatttatgttgatcgaaat
gatgatggaaatggcacattcaatcgatataagaaaatgtcctttacttggtataaagga
gtgattgaatcaaatggagaatccttattcaaatag

DBGET integrated database retrieval system