KEGG   Streptococcus pneumoniae CGSP14 (serotype 14): SPCG_0624Help
Entry
SPCG_0624         CDS       T00690                                 

Gene name
glcK
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
spw  Streptococcus pneumoniae CGSP14 (serotype 14)
Pathway
spw00010  Glycolysis / Gluconeogenesis
spw00052  Galactose metabolism
spw00500  Starch and sucrose metabolism
spw00520  Amino sugar and nucleotide sugar metabolism
spw00521  Streptomycin biosynthesis
spw01100  Metabolic pathways
spw01110  Biosynthesis of secondary metabolites
spw01120  Microbial metabolism in diverse environments
spw01130  Biosynthesis of antibiotics
spw01200  Carbon metabolism
Module
spw_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
spw_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:spw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPCG_0624 (glcK)
   00052 Galactose metabolism
    SPCG_0624 (glcK)
   00500 Starch and sucrose metabolism
    SPCG_0624 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    SPCG_0624 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SPCG_0624 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SPCG_0624 (glcK)
Enzymes [BR:spw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SPCG_0624 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N
Motif
Other DBs
NCBI-ProteinID: ACB89876
UniProt: B2IMY0
Position
633043..634020
Genome map
AA seq 325 aa AA seqDB search
MKKENMMSQKIIGIDLGGTSIKFAILTTAGEIQGKWSIKTNILDEGSHIVDDMIESIQHR
LDLLGLAAADFQGIGMGSPGVVDRDKGTVIGAYNLNWKTLQPIKQKIEKALGIPFFIDND
ANVAALGERWMGAGDNQPDVVFMTLGTGVGGGIVAEGKLLHGVAGAAGELGHITVDFDQP
ISCTCGKKGCLETVASATGIVNLTRRYADEYEGDAALKRLIDNGEEVTAKTVFDLAKEGD
DLALIVYRNFSRYLGIACANIGSILNPSTIVIGGGVSAAGEFLLQGVQKVYDENSFPQVR
TSTKLALATLGNDAGVIGAASLVLQ
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaggagaatatgatgagtcaaaagattattgggattgaccttggtggaacttct
atcaaatttgcaatcttaacaacagcaggagaaatccaaggaaaatggtcaatcaagacc
aacattttggatgagggaagtcatatcgttgatgatatgattgagtctattcaacatcgt
ttggacttgcttggattggcagcagcggacttccaaggcattggaatgggatcaccaggt
gtggttgaccgtgacaaagggactgttatcggtgcctacaacttgaactggaaaaccctt
caaccaatcaaacaaaagattgaaaaagctttgggcattccatttttcatcgataatgat
gccaacgtagcagctcttggtgagcgctggatgggtgctggagataaccaaccagacgtt
gtctttatgacactcggtactggtgttggtggtggtattgtcgcagaaggcaaattgctt
catggtgttgctggtgcagcaggtgaacttggtcatatcactgttgactttgaccaacca
atctcatgtacttgtggtaaaaaaggctgccttgagacagttgcttcagcaacagggatt
gtcaacttgactcgtcgctatgccgatgaatacgaaggcgatgcagccttgaaacgcttg
attgataacggagaagaagtaactgctaagactgtctttgatctcgcaaaagaaggagac
gaccttgctttgattgtttaccgtaacttctcacgttacttgggaatcgcttgtgctaac
attggttcaatcctaaacccatcaacaatcgtcatcggtggtggtgtgtcagctgcggga
gaattccttctacaaggtgttcaaaaagtttacgatgaaaatagtttcccacaagtacgc
acatctactaaattagctcttgcaactctaggaaatgacgctggagttatcggagcagca
tcacttgtattgcaataa

DBGET integrated database retrieval system