KEGG   Streptococcus pneumoniae CGSP14 (serotype 14): SPCG_0872Help
Entry
SPCG_0872         CDS       T00690                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
spw  Streptococcus pneumoniae CGSP14 (serotype 14)
Pathway
spw00010  Glycolysis / Gluconeogenesis
spw00030  Pentose phosphate pathway
spw00051  Fructose and mannose metabolism
spw00052  Galactose metabolism
spw00680  Methane metabolism
spw01100  Metabolic pathways
spw01110  Biosynthesis of secondary metabolites
spw01120  Microbial metabolism in diverse environments
spw01130  Biosynthesis of antibiotics
spw01200  Carbon metabolism
spw01230  Biosynthesis of amino acids
spw03018  RNA degradation
Module
spw_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:spw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPCG_0872 (pfkA)
   00030 Pentose phosphate pathway
    SPCG_0872 (pfkA)
   00051 Fructose and mannose metabolism
    SPCG_0872 (pfkA)
   00052 Galactose metabolism
    SPCG_0872 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    SPCG_0872 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SPCG_0872 (pfkA)
Enzymes [BR:spw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SPCG_0872 (pfkA)
Protein phosphatases and associated proteins [BR:spw01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SPCG_0872 (pfkA)
Messenger RNA biogenesis [BR:spw03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SPCG_0872 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: ACB90124
UniProt: B2IP53
Position
859129..860136
Genome map
AA seq 335 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRQAISEGMEVFGIYDGYAGMVAGEIHPLDAASVGDI
ISRGGTFLHSARYPEFAQLEGQLKGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAI
GLPGTIDNDIVGTDFTIGFDTAVTTAMDAIDKIRDTSSSHRRTFVIEVMGRNAGDIALWA
GIATGADEIIIPEAGFKMEDIVASIKAGYECGKKHNIIVLAEGVMSAAEFGQKLKEAGDT
SDLRVTELGHIQRGGSPTARDRVLASRMGTHAVKLLKEGIGGVAVGIRNEKMVENPILGT
AEEGALFSLTAEGKIVVNNPHKADIELSSLNKSLS
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttgactagtggcggagacgcacctggtatgaacgctgccatc
cgtgcagttgttcgtcaagcaatttcagaaggaatggaagtttttggtatctatgacgga
tatgctggtatggttgccggtgaaattcatcccctagatgcagcttcagtaggggacatc
atttctcgtggtggtactttccttcactcagctcgttacccagagttcgctcaacttgaa
gggcaacttaaagggattgagcaattgaaaaaacacggaattgaaggtgtagttgttatc
ggtggtgacggatcttaccacggcgctatgcgtttgactgaacatggcttcccagctatt
ggtcttccaggtacaatcgataacgatatcgttggtactgactttacaatcggttttgac
acagcggttactactgccatggacgctattgataagattcgtgatacatcatcaagtcac
cgtcgtacttttgtaatcgaagttatgggacgtaacgctggtgatatcgctctttgggct
ggtattgcaactggtgctgatgaaatcatcatccctgaagcaggcttcaagatggaagat
atcgtagcaagcatcaaagctggttatgaatgtggtaaaaaacacaatatcatcgtctta
gctgaaggtgtgatgtcagcggctgaatttggtcaaaaacttaaagaagctggagataca
agcgaccttcgtgtaacagaacttggacatattcaacgtggtggttctccaactgcgcgt
gaccgtgttttggcgtcacgtatgggtacacatgctgttaaacttcttaaagaaggtatc
ggtggtgttgcggttggtattcgtaacgaaaaaatggttgaaaatccaattcttggtact
gcagaagaaggggcattgtttagccttactgcagaaggtaagattgtggttaacaaccca
cacaaagccgatattgagctatctagcttgaataagagcttgtcataa

DBGET integrated database retrieval system