KEGG   Streptococcus pneumoniae CGSP14 (serotype 14): SPCG_1135Help
Entry
SPCG_1135         CDS       T00690                                 

Gene name
acoC
Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
spw  Streptococcus pneumoniae CGSP14 (serotype 14)
Pathway
spw00010  Glycolysis / Gluconeogenesis
spw00020  Citrate cycle (TCA cycle)
spw00620  Pyruvate metabolism
spw01100  Metabolic pathways
spw01110  Biosynthesis of secondary metabolites
spw01120  Microbial metabolism in diverse environments
spw01130  Biosynthesis of antibiotics
spw01200  Carbon metabolism
Module
spw_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:spw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPCG_1135 (acoC)
   00020 Citrate cycle (TCA cycle)
    SPCG_1135 (acoC)
   00620 Pyruvate metabolism
    SPCG_1135 (acoC)
Enzymes [BR:spw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SPCG_1135 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding
Motif
Other DBs
NCBI-ProteinID: ACB90387
UniProt: B2IPW3
Position
1105275..1106402
Genome map
AA seq 375 aa AA seqDB search
MASSKPSSISYFSVAFDALCIINRIGEVMADDKLRATPAARKLADDLGINLYDVSGSGAN
GRVHKEDVETYKDTNVVRISPLAKRIALEHNIAWQEIQGTGHRGKIMKKDVLALLPENIE
NDSIKSPAQIEKVEEVPDNVTPYGEIERIPMTPMRKVIAQRMVESYLTAPTFTLNYEVDM
TEMLALRKRVLEPIMEATGKKTTVTDLLSLAVVKTLMKHPYINASLTEDGKTIITHNYVN
LAMAVGMDNGLMTPVVYNAEKMSLSELVVAFKDVIGRTLDGKLAPSELQNSTFTISNLGM
FGVQSFGPIINQPNSAILGVSSTIEKPVVVNGEIVIRPIMSLGLTIDHRVVDGMAGAKFM
KDLKELIETPISMLI
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
ttggcttcatcgaagccatcgtcgatttcctatttttcagtcgcttttgacgccctttgt
atcataaatagaattggagaggtcatggctgatgacaagctaagagcgactcctgcagct
agaaagttagcagatgatttagggataaacctctacgacgtttctggctcaggtgcaaac
ggtcgtgtccacaaagaagacgtggaaacttataaagacacaaacgtggttcgcatttcg
ccacttgcaaaacgaattgccctcgaacataacattgcttggcaggaaatccaaggaacc
ggtcatcgtggtaaaatcatgaagaaggatgttttggccctgcttcctgaaaatatcgaa
aacgatagcatcaaatctcctgctcagattgaaaaagtggaagaagtccctgataacgta
acaccatatggtgaaatcgagcgtattccaatgacaccaatgcgtaaggttattgcccaa
cgcatggttgaatcttacttgactgcgccaaccttcaccctcaactatgaagttgatatg
actgaaatgttggctcttcgtaagagggttcttgagccaatcatggaagcaactgggaag
aagactactgtaacagaccttctttcacttgcagttgttaagactcttatgaaacatcca
tacatcaacgcttcattgacagaagatggcaagactattatcactcacaactatgtcaat
cttgccatggcagttgggatggataatggattgatgacacctgttgtttacaatgctgag
aagatgagtctttcagaactggttgtagcctttaaggatgttattggccgtaccttggat
ggtaaattggctccaagtgagttacaaaattcaacattcacaatcagtaatttgggaatg
tttggtgttcagtcctttggtccgattattaaccaacccaactcagctatccttggtgtc
agttcgacaatcgagaagccagttgtcgtcaatggtgaaattgtgattcgcccaatcatg
agtttaggattaaccattgaccaccgtgtcgtagatggtatggctggtgctaagtttatg
aaggacttgaaagagttgattgaaacgccaatctcaatgttaatttaa

DBGET integrated database retrieval system