KEGG   Streptococcus pneumoniae CGSP14 (serotype 14): SPCG_1795Help
Entry
SPCG_1795         CDS       T00690                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
spw  Streptococcus pneumoniae CGSP14 (serotype 14)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:spw00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SPCG_1795 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPCG_1795 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SPCG_1795 (trpA)
Enzymes [BR:spw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SPCG_1795 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1778616..1779461)
Genome map
AA seq 281 aa AA seqDB search
MGTRMWFKSRIAWKQMQQRREKLMPKTLTEKLNAIKAAGKGIFVPYIMAGDHEKGLDGLA
ETIHFLEDLGVSAIEVGIPFSDPVADGPVIEEAGLRSLAHGTSTQALVETLKTIETEVPL
VIMTYFNPLFQYGVANFVKDLADTGVKGLIIPDLPHEHANFVEPFLADTDIALIPLVSLT
TGIERQKELIEGAEGFIYAVAINGVTGKSGNYRADLDKHLAQLHQVADIPVLTGFGVSSQ
ADLERFNAVSDGVIVGSKIVKALHQGEPIQDFIKQAVAYQK
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
gtggggacaaggatgtggttcaagtcaaggatcgcttggaagcagatgcagcaaagaagg
gagaagctcatgcctaagacactaacagaaaaattgaacgctattaaagcagctggaaaa
ggaattttcgttccctatatcatggctggtgaccacgaaaaaggtttggacggtcttgct
gaaacaattcactttttagaagatttgggtgtctctgcaattgaagtgggcattcccttt
tcagatcctgtcgcagatggacctgttatcgaagaagctggcttgcgcagtttagcccac
gggacctctacccaggctttggttgaaactttgaaaaccattgaaacagaggttccactt
gtcatcatgacctactttaaccccctctttcagtacggtgtggcgaactttgtcaaagat
ttggcagatacaggggttaagggcttgattatcccagacctgcctcatgagcatgccaac
tttgtagaaccatttttggcagatacagatatcgccttgattcctttagtaagcttgacc
acaggaattgagcgccagaaagagttgattgaaggggcggagggattcatctatgccgtt
gccatcaatggagtgacagggaaatcaggcaattaccgtgcagatttggacaagcacttg
gcgcaacttcatcaagtggccgacatcccagtcttgacaggttttggtgtatctagtcaa
gccgatctggaacgcttcaatgcggtgtcagatggtgttatcgtcggttcgaaaatagta
aaagctctccaccaaggagagccgattcaggactttatcaaacaagcagtagcttaccaa
aaataa

DBGET integrated database retrieval system