KEGG   Streptococcus pneumoniae CGSP14 (serotype 14): SPCG_1796Help
Entry
SPCG_1796         CDS       T00690                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
spw  Streptococcus pneumoniae CGSP14 (serotype 14)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:spw00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SPCG_1796 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPCG_1796 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SPCG_1796 (trpB)
Enzymes [BR:spw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SPCG_1796 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1779385..1780608)
Genome map
AA seq 407 aa AA seqDB search
MAYQEPNKDGFYGKFGGRFVPETLMTAVLELEKAYRESQADPSFQEELNQLLRQYVGRET
PLYYAKNLTQHIGGAKIYLKREDLNHTGAHKINNALGQVWLAKRMGKKKIIAETGAGQHG
VATATAAALFNMECTIYMGEEDVKRQALNVFRMELLGAKVEAVTDGSRVLKDAVNAALRS
WVANIDDTHYILGSALGPHPFPEIVRDFQSVIGREAKQQYRDMTGQNLPDALVACVGGGS
NAIGLFHPFVEDESVAMYGTEAAGLGVDTEHHAATLTKGRPGVLHGSLMDVLQDAHGQIL
EAFSISAGLDYPGIGPEHSHYHDIKRASYVPVTDEEALEGFQLLSRVEGIIPALESSHAI
AFAVKLAKELGPEKSMIVCLSGRGDKDVVQVKDRLEADAAKKGEAHA
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcatatcaggaaccaaataaagatggattttacggaaaattcggcggacgttttgtc
ccagaaacattgatgacagcagttttggagttggagaaggcctatcgtgaaagtcaggca
gacccaagtttccaagaggaattaaaccaactcttgcgccagtatgtggggcgggaaact
cctctttactacgcaaaaaacttgacccagcatattggcggagccaagatttatctcaaa
cgggaagaccttaaccatacaggagcccacaagattaacaatgccttaggacaagtttgg
cttgccaaacgcatgggtaaaaagaaaattatcgcagaaaccggtgctggtcagcacggt
gtggcaactgcaactgctgcggccctctttaacatggaatgtaccatctacatgggtgag
gaagatgtcaaacgccaagccctcaatgtcttccgcatggagcttttgggagccaaggtc
gaggctgtaacagatggttcgcgcgtgctcaaggatgcggtcaatgcagcccttcgttca
tgggtggctaatatcgacgatacccactatatccttggttctgccttggggcctcatcca
tttccagaaatcgttcgtgacttccaaagtgtcatcggtcgcgaagctaaacaacagtat
cgcgatatgacaggtcaaaatctgcccgatgctctagtagcctgtgttggtggtggatct
aatgctattgggctcttccatccctttgtagaagatgagtcagtagctatgtatggaact
gaagcagcagggcttggtgtggatacggagcaccacgctgctaccttgaccaagggtcgt
ccgggtgttcttcacggttctctcatggatgtgctccaagatgcccatggtcaaattctt
gaagccttctctatctcagcaggtttggactatcctggtatcggtccagagcattctcac
taccacgatattaaacgtgccagctatgtccctgtgacagacgaagaagccttggaagga
ttccaactcttgtctcgtgtggaagggattatcccagctttggaatctagccatgctatc
gcttttgcggtgaaattggccaaagaacttggaccagaaaagtctatgattgtctgccta
tcgggtcgtggggacaaggatgtggttcaagtcaaggatcgcttggaagcagatgcagca
aagaagggagaagctcatgcctaa

DBGET integrated database retrieval system