KEGG   Streptococcus pneumoniae CGSP14 (serotype 14): SPCG_1798Help
Entry
SPCG_1798         CDS       T00690                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
spw  Streptococcus pneumoniae CGSP14 (serotype 14)
Pathway
spw00400  Phenylalanine, tyrosine and tryptophan biosynthesis
spw01100  Metabolic pathways
spw01110  Biosynthesis of secondary metabolites
spw01130  Biosynthesis of antibiotics
spw01230  Biosynthesis of amino acids
Module
spw_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:spw00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SPCG_1798 (trpC)
Enzymes [BR:spw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SPCG_1798 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NeuB DUF5390 Rho_N
Motif
Other DBs
NCBI-ProteinID: ACB91050
UniProt: B2ISS3
Position
complement(1781172..1781939)
Genome map
AA seq 255 aa AA seqDB search
MSQEFLARILEQKAREVEQMKLEQIQPLRQTYRLAEFLKNHQDRLQVIAEVKKASPSLGD
INLDVDIVQQAQTYEENGAVMISVLTDEVFFKGHLDYLREISSQVEIPTLNKDFIIDEKQ
IIRARNAGATVILLIVAALSEERLKELYDYATELGLEVLVETHNLAELEVAHRLGAEIIG
VNNRNLTTFEVDLQTSVDLAPYFEEGRYYISESAIFTGQDAERLAPYFNGILVGTALMQA
ENVAQRIKELQIDKG
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaggaatttttagcacgaatcttagagcagaaggcgcgtgaggtggagcagatg
aagctggagcaaatccagcctctgcgccagacctatcgcttggcagaatttttgaagaat
catcaggaccgcttgcaggtaatcgctgaggtcaagaaagctagccctagtttgggagat
atcaatctcgatgtggatattgtgcaacaggcccagacttatgaagaaaacggagcagtg
atgatttcggtgttgacagatgaggttttctttaaagggcatttggattatctacgggaa
atttccagtcaggtagagattccgacgctcaacaaagactttatcatagatgaaaagcaa
atcatccgcgctcgcaatgcaggtgcgacagttatcttgcttattgtggcagccttgtcc
gaagaacgcctcaaggaactgtatgactacgcgacagagcttggtctggaagtcttagtg
gagactcacaatctagctgaactagaggtagcccacagacttggtgctgagattattggg
gtcaacaaccgcaacttgactacctttgaggtcgacttgcagaccagtgtagatttagcc
ccttactttgaggaaggtcgctattacatttctgaatctgccattttcacagggcaggat
gcggaacgactagccccatactttaacggaattttggtagggacagctcttatgcaggca
gaaaatgtggcccagagaatcaaggagttgcagattgacaaaggttaa

DBGET integrated database retrieval system