KEGG   Streptococcus pneumoniae CGSP14 (serotype 14): SPCG_1829Help
Entry
SPCG_1829         CDS       T00690                                 

Gene name
adhB
Definition
(GenBank) alcohol dehydrogenase, zinc-containing
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
spw  Streptococcus pneumoniae CGSP14 (serotype 14)
Pathway
spw00010  Glycolysis / Gluconeogenesis
spw00625  Chloroalkane and chloroalkene degradation
spw00626  Naphthalene degradation
spw01100  Metabolic pathways
spw01110  Biosynthesis of secondary metabolites
spw01120  Microbial metabolism in diverse environments
spw01130  Biosynthesis of antibiotics
spw01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:spw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPCG_1829 (adhB)
  Lipid metabolism
   00071 Fatty acid degradation
    SPCG_1829 (adhB)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SPCG_1829 (adhB)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SPCG_1829 (adhB)
   00626 Naphthalene degradation
    SPCG_1829 (adhB)
Enzymes [BR:spw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SPCG_1829 (adhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C AlaDh_PNT_C Sacchrp_dh_NADP Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: ACB91081
UniProt: B2ISV4
Position
complement(1813901..1814938)
Genome map
AA seq 345 aa AA seqDB search
MKSAVYTKAGQVGLASIERPQIIEADDVIIRVVRACVCGSDLWRYRNPETKAGHKNSGHE
AIGIVEEAGEAITTVKPGDFVIVPFTHGCGECDACLAGFDGSCDNHIGNNLGGDFQAEYI
RFHYANWALVKIPGQPSDYTEGMLKSLLTLADVMPTGYHAARVANVQKGDKVVVIGDGAV
GQCAVIAAKMRGASQIILMSRHEDRQKMAMESGATAVVAERGQEGITKVREILGGGADAA
LECVGTEAAIEQALGVLHNGGRMGFVGVPHYNNRALGSTFMQNISVAGGAASATTYDKQF
LLKAVLDGDINPGRVFTSSYKLEDIDQAYKDMDERKTIKSMIVIE
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcagcagtatatacaaaggcaggtcaggttggacttgctagcattgaacgtccg
caaataatagaagcggatgatgtgattattcgtgtggttcgtgcgtgcgtttgtggttca
gatttatggaggtaccgtaatccagaaacgaaagctggacataaaaatagtggacacgaa
gcgattgggattgttgaagaagctggggaagccattacgacggtgaaaccaggtgatttt
gtgattgtcccttttacacatggatgtggtgagtgtgatgcctgtcttgctggatttgac
ggttcttgcgacaatcatattggtaataatttggggggtgattttcaggcagaatatatt
cgcttccactatgcaaactgggcgctggttaaaatccctggtcaaccttctgattataca
gaagggatgctcaagtcccttttgactcttgcagatgtcatgccgacaggctatcatgca
gcgcgtgttgcaaatgttcaaaaaggggacaaggttgttgttatcggtgatggggctgtt
ggtcaatgtgctgtcatcgcggctaagatgcgtggagcatcacaaattatccttatgagc
cgtcatgaagaccgtcaaaagatggctatggagtcaggtgcgacagctgttgttgcagaa
cgtggtcaagaaggaattaccaaggtgcgtgaaatcctcggcggaggagcagacgcagca
cttgaatgtgttggtacggaggctgctatagaacaggcgctaggtgttcttcataatgga
gggcgtatgggctttgtaggagtcccacactataataatcgtgctcttggttcgacattt
atgcaaaatatctctgtagcaggtggggcagcttctgctacaacatacgataagcaattt
ttactaaaagccgtccttgatggtgatatcaatccaggtcgcgtctttacttcaagttat
aaactggaagatatcgaccaagcctataaagatatggatgaacgtaagacaattaagtct
atgattgtaatcgaataa

DBGET integrated database retrieval system