KEGG   Streptococcus pneumoniae CGSP14 (serotype 14): SPCG_1867Help
Entry
SPCG_1867         CDS       T00690                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
spw  Streptococcus pneumoniae CGSP14 (serotype 14)
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:spw00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SPCG_1867
Enzymes [BR:spw01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     SPCG_1867
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1850552..1852024)
Genome map
AA seq 490 aa AA seqDB search
MASIRKRRVMMPIQNKTMLITYSDSLGNNLKDLYDNLEEHFGDAIGGVHLLPFFPSTGDR
GFAPVDYDEVDSAFGDWEDVKHLGEKYYLMFDFMINHISRQSKYYKDYQEKHEASEFKAL
FLNWDKFWPENRPTQSDVDLIYKRKDRAPKQEIVFEDGSVEHLWNTFGEEQIDLDVTKEV
TMEFIRKTIQHLASNGCDLIRLDAFAYAVKKLDTNDFFVEPDIWDLLDKVRDIAAEYGTE
LLPEIHEHYSIQFKIADHDYYVYDFALPMVTLYTLYSSRTERLAKWLKMSPMKQFTTLDT
HDGIGVVDVKDILTDEEIDYASNELYKVGANVKRKYSSAEYNNLDIYQINSTYYSALGDD
DVKYFLARLIQAFAPGIPQVYYVGLLAGKNDLKLLEETKEGRNINRHYYSNEEIAKEVQR
PVVKALLNLFSFRNRSEAFDLEGTTEIETPTAHSIVIKRQNKDKSVTAVVEIDLQNQTYR
VIENGVEVSF
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
ttggcttcaattagaaaaaggagagtaatgatgccaattcaaaataaaaccatgttgatt
acctattctgatagccttggaaataatcttaaagacttatatgataatttggaagagcat
tttggagatgctattggaggagttcaccttttaccatttttcccatcaacaggtgatcgt
ggatttgcgccagttgactacgacgaagtggactcagcttttggtgattgggaggatgtt
aagcatttaggtgagaaatattatcttatgtttgattttatgattaatcatatttctcgt
caatccaagtattataaggactatcaagaaaaacatgaagccagtgaatttaaagctctc
tttttaaactgggataagttttggccagaaaaccgtccgacacagtctgatgtagattta
atttacaagcgtaaggatcgtgcaccaaagcaagagattgtgtttgaagatggttcagtg
gaacatttgtggaatacctttggtgaggagcagattgatcttgatgtgaccaaagaagta
actatggaatttatccgtaagaccattcagcacttggcaagtaatgggtgtgatttgatt
cgtctagatgcctttgcttatgcagtgaagaaattggatactaatgatttctttgtggaa
ccagatatttgggatttattggacaaagttcgagatatcgctgctgagtatgggacagag
cttttacctgagattcatgaacactattcgattcagtttaaaatagcagaccatgattac
tatgtttatgattttgctcttccaatggtgacactttatactctttacagttccagaaca
gagcgtttggctaagtggttaaagatgagcccgatgaagcaatttacgacgctagatacc
catgatgggattggagtagtagatgtcaaggatatcctgaccgatgaggagattgactat
gcttcaaatgaactctataaggttggagccaatgtcaaacgtaagtactctagtgccgag
tataacaacttagatatctaccaaatcaattcaacctactattcagcgcttggagatgat
gatgtcaagtattttctcgctcgtctaattcaagcttttgccccaggtattcctcaggtt
tactatgtgggtctattagcaggcaagaatgacttgaaattattagaagaaactaaagaa
ggtcgaaatattaatcgtcattactatagcaacgaggaaatagcaaaagaagtgcaacga
cctgttgtgaaggcccttctcaatctattttctttccgtaaccgttcagaagcctttgat
ctagaagggactactgagatagagacaccaacagctcacagcattgtaatcaaacgtcaa
aataaagataagtccgtaacagcagtagtagaaattgatttgcaaaatcagacttatcgg
gtaattgagaatggagttgaagtatcattttga

DBGET integrated database retrieval system