KEGG   Streptococcus pneumoniae CGSP14 (serotype 14): SPCG_1991Help
Entry
SPCG_1991         CDS       T00690                                 

Gene name
adhE
Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
spw  Streptococcus pneumoniae CGSP14 (serotype 14)
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:spw00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SPCG_1991 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPCG_1991 (adhE)
   00620 Pyruvate metabolism
    SPCG_1991 (adhE)
   00650 Butanoate metabolism
    SPCG_1991 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    SPCG_1991 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SPCG_1991 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SPCG_1991 (adhE)
   00626 Naphthalene degradation
    SPCG_1991 (adhE)
Enzymes [BR:spw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SPCG_1991 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SPCG_1991 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1977495..1980167)
Genome map
AA seq 890 aa AA seqDB search
MKAMEENMADKKTVTPEEKKLVAEKHVDELVQKALVALEEMRKLDQEQVDYIVAKASVAA
LDAHGELALHAFEETGRGVFEDKATKNLFACEHVVNNMRHTKTVGVIEEDDVTGLTLIAE
PVGVVCGITPTTNPTSTAIFKSLISLKTRNPIVFAFHPSAQESSAHAARIVRDAAIAAGA
PENCVQWITQPSMEATSALMNHEGVATILATGGNAMVKAAYSCGKPALGVGAGNVPAYVE
KSANIRQAAHDIVMSKSFDNGMVCASEQAVIIDKEIYDEFVAEFKSYHTYFVNKKEKALL
EEFCFGVKANSKNCAGAKLNADIVGKPATWIAEQAGFTVPEGTNILAAECKEVGENEPLT
REKLSPVIAVLKSESREDGITKARQMVEFNGLGHSAAIHTADEELTKEFGKAVKAIRVIC
NSPSTFGGIGDVYNAFLPSLTLGCGSYGRNSVGDNVSAINLLNIKKVGRRRNNMQWMKLP
SKTYFERDSIQYLQKCRDVERVMIVTDHAMVELGFLDRIIEQLDLRRNKVVYQIFADVEP
DPDITTVNRGTEIMRAFKPDTIIALGGGSPMDAAKVMWLFYEQPEVDFRDLVQKFMDIRK
RAFKFPLLGKKTKFIAIPTTSGTGSEVTPFAVISDKANNRKYPIADYSLTPTVAIVDPAL
VLTVPGFVAADTGMDVLTHATEAYVSQMASDYTDGLALQAIKLVFENLESSVKNADFHSR
EKMHNASTIAGMAFANAFLGISHSMAHKIGAQFHTIHGRTNAILLPYVIRYNGTRPAKTA
TWPKYNYYRADEKYQDIARMLGLPASTPEEGVESYAKAVYELGERIGIQMNFRDQGIDEK
EWKEHSRKLAFLAYEDQCSPANPRLPMVDHMQEIIEDAYYGYKERPGRRK
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagctatggaggaaaatatggctgataaaaaaactgtgacaccagaggaaaagaaa
ctcgttgctgaaaaacacgtagatgagttggttcaaaaagctctagttgcccttgaagaa
atgcgtaaattggatcaagaacaagttgactacatcgttgccaaagcatcagtagcagct
ttggatgcccacggagaattggctttacatgcctttgaagaaacaggacgtggtgtattt
gaagacaaagcaactaagaacttgtttgcctgtgaacacgtagtaaacaacatgcgccac
actaagacagttggcgttatcgaagaagacgatgtaacaggattgactcttattgctgaa
ccagttggtgttgtttgtggtattactccaacaacaaacccaacatcaacagcaatcttc
aaatcattgatttcattgaagacacgtaacccaatcgtctttgccttccatccatcagca
caagaatcatctgctcatgcagctcgtatcgtccgcgatgcagctatcgcagctggtgct
cctgaaaactgtgtgcaatggattactcaaccatctatggaagcaacaagtgcccttatg
aaccacgaaggtgttgcgacaatccttgcaacaggtggtaatgccatggttaaggcggct
tattcatgtggtaaaccagctcttggggtaggtgccggaaacgttccagcttatgttgaa
aaatcagcaaacattcgtcaagcagcacacgatatcgtcatgtctaaatcatttgataac
ggtatggtctgtgcatctgaacaagcagttatcattgataaagaaatttacgatgaattt
gtagcagagttcaaatcttaccacacttactttgtaaacaaaaaagaaaaagctcttctt
gaagagttctgcttcggcgtcaaagcaaacagcaaaaactgtgctggtgcaaaattgaac
gctgacatcgttggtaaaccagcaacttggattgcagaacaagcaggatttacagttcca
gaaggaacaaacattcttgctgcagaatgtaaagaagttggcgaaaatgagccattgact
cgtgaaaaattgtcaccagttattgcagttttgaaatctgaaagccgtgaagatggtatt
actaaggctcgtcaaatggttgaatttaacggtcttggacactcagcagctatccacaca
gctgacgaagaattgactaaagaatttggtaaagctgttaaagctattcgtgttatctgt
aactcaccttctacttttggtggtatcggggacgtttacaatgccttcttgccatcattg
acacttggatgtggttcttacggacgcaactcagttggggataacgttagtgccattaac
ctcttgaatatcaaaaaagtcggaagacggagaaataacatgcaatggatgaaacttcct
tcaaaaacatactttgaacgtgattcaattcaataccttcaaaaatgtcgtgacgttgaa
cgtgtcatgatcgttactgaccatgccatggtagagcttggtttccttgatcgtatcatc
gaacaactggaccttcgtcgcaataaggttgtttaccaaatctttgcggatgtagaaccg
gatccagatatcacaactgtaaaccgtggtactgagattatgcgtgccttcaaaccagat
accatcatcgcactcggtggtgggtctccaatggatgctgccaaagtaatgtggctcttc
tacgagcaaccagaagtggacttccgtgaccttgtccaaaaattcatggatatccgtaaa
cgtgccttcaagttcccattgcttggtaagaagactaaattcatcgcgattccaactaca
tctggtacaggatctgaagtaacaccatttgccgttatctctgataaagcaaacaaccgt
aaatacccaatcgctgactactcattgacaccaactgtggcaatcgtagatcctgctttg
gtattgacagttccaggatttgttgctgctgatactggtatggacgtattgactcacgcg
acagaagcatacgtatcacaaatggctagtgactacactgatggtttagcacttcaagcc
attaaattggtctttgaaaatctcgaaagctcagttaagaatgcagacttccactcacgt
gagaaaatgcataacgcttcaacaatcgctggtatggcctttgccaatgccttcctaggt
atttctcactcaatggcccataagattggtgcgcaattccacacaatccacggtcgtaca
aatgctatcttgcttccatacgttatccgttacaacggtacacgtccagctaagacagca
acatggcctaagtacaactactaccgtgcagatgaaaaataccaagatatcgcacgcatg
cttggacttccagcttctactccagaagaaggggttgaatcttacgcaaaagctgtctac
gaactcggtgaacgtattgggatccaaatgaattttagagaccaaggaattgacgaaaaa
gaatggaaagaacattctcgtaaattagccttcctggcttatgaagaccaatgttcacca
gctaacccacgtcttccaatggtagaccatatgcaagaaatcatcgaagatgcatactat
ggctacaaagaaagaccaggacgccgtaaataa

DBGET integrated database retrieval system