KEGG   Streptococcus pneumoniae CGSP14 (serotype 14): SPCG_2022Help
Entry
SPCG_2022         CDS       T00690                                 

Gene name
adh
Definition
zinc-containing alcohol dehydrogenase
Orthology
K18369  
alcohol dehydrogenase [EC:1.1.1.-]
Organism
spw  Streptococcus pneumoniae CGSP14 (serotype 14)
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:spw00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SPCG_2022 (adh)
Enzymes [BR:spw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     SPCG_2022 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2001883..2002941)
Genome map
AA seq 352 aa AA seqDB search
MKAYTYVKPGLASFVDVDKPVIRKPTDAIVRIVKTTICGTDLHIIKGDVPTCQSGTILGH
EGIGIVEEVGEGVSNFKKGDKVLISCVCACGKCYYCKKGIYAHCEDEGGWIFGHLIDGMQ
AEYLRVPHADNTLYHTPEDLSDEALVMLSDILPTGYEIGVLKGKVEPGCSVAIIGSGPVG
LAALLTAQFYSPAKLIMVDLDDNRLETALSFGATHKVNSSDPEKAIKEIYDLTDGRGVDV
AIEAVGIPATFDFCQKIIGVDGTVANCGVHGKPVEFDLDKLWIRNINVTTGLVSTNTTPQ
LLKALESHKIEPEKLVTHYFKLSEIEKAYEVFSKAADHHAIKVIIENDISEA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcctatacttatgttaaaccaggacttgcttcttttgttgatgtagacaaacca
gttattcgcaagccaacagacgctattgtgcgtattgtaaaaaccactatttgtggaaca
gacctccatattatcaaaggggatgttcctacttgccaaagtggtaccattcttggccac
gaagggattgggattgttgaagaagttggggaaggagtttccaacttcaaaaaaggcgac
aaggtcttgatttcttgcgtctgtgcctgtggtaaatgctactactgtaaaaaaggaatt
tatgcccactgtgaagacgaagggggctggattttcggtcacttgattgatggtatgcag
gctgaatatctacgtgtccctcatgcagataatactctttaccatactccagaagacttg
tcagatgaagctttggttatgctgtcagacattctgcctactggatatgaaattggtgtc
ttaaaagggaaagtagaacctggttgcagcgtagccattattggttcaggtccagttgga
ttggctgctcttttaacagcccaattctattcaccagctaaattgattatggtagaccta
gacgataaccgcttggaaactgccctatcattcggtgcgactcataaggttaattcttca
gaccctgaaaaagccattaaagaaatttatgatttgacagatggtcgtggtgtggatgtc
gctatcgaagctgttggtattcctgcaacatttgatttctgtcaaaagattatcggtgta
gacggaacggttgccaactgtggtgtgcatggtaaaccagttgaattcgatttagataaa
ctttggattcgcaacatcaatgtaacaactggtttggtatctacaaatacgactccacaa
ttgttgaaagcacttgaaagtcataagattgaaccagaaaaattggtaactcactatttc
aaactcagtgaaattgaaaaagcctatgaagtcttcagtaaggcagcagaccaccatgcc
attaaggtcattatcgaaaacgatatctcagaagcctaa

DBGET integrated database retrieval system