KEGG   Streptococcus pneumoniae CGSP14 (serotype 14): SPCG_2071Help
Entry
SPCG_2071         CDS       T00690                                 

Gene name
malM
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
spw  Streptococcus pneumoniae CGSP14 (serotype 14)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:spw00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2063628..2065145)
Genome map
AA seq 505 aa AA seqDB search
MKKRQSGVLMHISSLPGAYGIGSFGQSAYDFVDFLVRTKQRYWQILPLGATSYGDSPYQS
FSAFAGNTHFIDLDILVEQGLLEASDLEGVDFGSDASEVDYAKIYYARRPLLEKAVKRFF
EVGDVKDFEKFAQDNQSWLELFAEYMAIKEHFDNLAWTEWPDADARARKASALESYREQL
ADKLVYHRVTQYFFFQQWLKLKAYANDNHIEIVGDMPIYVAEDSSDMWANPHLFKTDVNG
KATCIAGCPPDEFSVTGQLWGNPIYDWEAMDKDGYKWWIERLRESFKIYDIVRIDHFRGF
ESYWEIPAGSDTAAPGEWVKGPGYKLFAAVKEELGELNIIAEDLGFMTDEVIELRERTGF
PGMKILQFAFNPEDESIDSPHLAPANSVMYTGTHDNNTVLGWYRNEIDDATREYMARYTN
RKEYETVVHAMLRTVFSSVSFMAIATMQDLLELDEAARMNFPSTLGGNWSWRMTEDQLTP
AVEEGLLDLTTIYRRINENLVDLKK
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacgtcaaagtggtgtgttgatgcacatctcttctcttccaggagcttacgga
atcggatcatttggtcaaagtgcttacgacttcgttgatttcttggtccgtacaaaacaa
cgttactggcaaatccttccattaggagcaactagttacggggattctccttaccaatct
ttctcagccttcgcaggaaacactcattttatcgatttagatatcttggtggagcaaggt
ttgttggaagcaagtgaccttgaaggagttgactttggtagcgatgcgtctgaagttgac
tatgctaaaatctactatgcacgtcgtcctcttttagaaaaagcggtgaagcgtttcttt
gaagtcggagatgttaaagattttgagaaatttgctcaagacaaccaatcatggcttgag
ctctttgctgagtatatggctatcaaagagcattttgacaatcttgcttggactgaatgg
ccagatgcagatgctcgtgctcgtaaagcttcagcacttgaaagctatcgtgagcaattg
gcagacaagttggtttaccaccgtgtgactcaatacttcttcttccaacaatggttgaaa
ttgaaagcttacgctaacgacaaccacatcgaaatcgttggggacatgccaatctacgta
gcggaagattcaagtgatatgtgggcaaatccacatctcttcaaaacagatgtcaatggt
aaggctacttgtatcgcaggatgtccaccagatgagttttctgtaactggtcagctttgg
ggtaacccaatctatgactgggaagcaatggacaaagacggctacaaatggtggattgaa
cgcttgcgtgaaagcttcaaaatctacgatatcgttcgtatcgaccacttccgtggcttc
gaatcttattgggaaatccctgctggttccgatacagcagcacctggtgagtgggtgaaa
ggtccaggctacaagctttttgcagccgttaaggaagaacttggtgagctaaacatcatc
gcagaagaccttggcttcatgacagatgaagtgatcgaattgcgtgaacgtactggcttc
ccaggaatgaagattcttcaatttgccttcaacccagaagacgaaagcattgatagccca
cacttggcacctgctaactcagttatgtacacaggaacacacgataacaatacggttctt
ggttggtaccgtaatgagattgatgatgcgactcgtgagtacatggctcgttacacgaac
cgtaaagaatacgaaacagtggtacacgctatgcttcgtacagtattttcatcagttagc
tttatggcaattgcgactatgcaagatttactagaattggatgaggcagctcgtatgaac
ttcccatctacccttggtggaaactggtcttggcgtatgactgaagatcaattgacacca
gctgtcgaggaaggtttgcttgacttgacaacaatttatcgccgaattaatgaaaatttg
gtagatttaaagaaataa

DBGET integrated database retrieval system