KEGG   Streptococcus pneumoniae CGSP14 (serotype 14): SPCG_2153Help
Entry
SPCG_2153         CDS       T00690                                 

Definition
hypothetical protein
Orthology
K00105  
alpha-glycerophosphate oxidase [EC:1.1.3.21]
Organism
spw  Streptococcus pneumoniae CGSP14 (serotype 14)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:spw00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2151025..2152851)
Genome map
AA seq 608 aa AA seqDB search
MEFSKKTRELSIKKMQERTLDLLIIGGGITGAGVALQAAASGLETGLIEMQDFAEGTSSR
STKLVHGGLRYLKQFDVEVVSDTVSERAVVQQIAPHIPKPDPMLLPVYDEDGATFSLFRL
KVAMDLYDLLAGVSNTPTANKVLSKDQVLERQPNLKKEGLVGGGVYLDFRNNDARLVIEN
IKRANQDGALIANHVKAEGFLFDESGKITGVVARDLLTDQVFEIKARLVINTTGPWSDKV
RNLSNKGTQFSQMRPTKGVHLVVDSSKIKVSQPVYFDTGLGDGRMVFVLPRENKTYFGTT
DTDYTGDLEHPKVTQEDVDYLLGIVNNRFPESNITIDDIESSWAGLRPLIAGNSASDYNG
GNNGTISDESFDNLIATVESYLSKEKTREDVESAVSKLESSTSEKHLDPSAVSRGSSLDR
DDNGLLTLAGGKITDYRKMAEGAMERVVDILKAEFDRSFKLINSKTYPVSGGELNPANVD
SEIEAFAQLGVSRGLDSKEAHYLANLYGSNAPKVFALAHSLEQAPGLSLADTLSLHYAMR
NELALSPVDFLLRRTNHMLFMRDSLDSIVEPVLDEMGRFYDWTEEEKATYRADVEAALAN
NDLAELKN
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atggaattttcaaagaaaacacgtgaattgtcaattaaaaaaatgcaggaacgcaccctg
gacctcttgattatcggtggaggaatcacaggagctggtgtagccttgcaggcggcagct
agcggtcttgagactggtttgattgaaatgcaagactttgcagaaggaacatctagtcgt
tcaacaaaattggttcacggaggacttcgttacctcaaacaattcgacgtcgaagtggtc
tcagatacggtttctgaacgtgcagtggttcaacaaatcgctccacacattccaaaacca
gacccaatgctcttaccagtttacgatgaagatggagcaacctttagcctcttccgtctt
aaagtagccatggacttgtacgacctcttggcaggtgttagcaacacaccaactgcgaac
aaggttttgagcaaggatcaagtcttggaacgccagccaaacttgaagaaggaaggcttg
gtaggaggtggagtgtatcttgacttccgtaacaacgatgcgcgtctcgtgattgaaaac
atcaaacgtgccaaccaagacggtgccctcattgccaaccacgtgaaggcagaaggcttc
ctctttgacgaaagtggcaagattacaggtgttgtagctcgtgatctcttgacagatcaa
gtatttgaaatcaaggcccgtctggttattaatacaacaggtccttggagtgataaagta
cgtaatttgtctaataagggaacgcaattctcacaaatgcgcccaactaagggagttcac
ttggtagtggattcaagcaaaatcaaggtttcacagccagtttactttgacacaggtttg
ggtgacggtcgtatggtctttgttctcccacgtgaaaacaagacttactttggtacaact
gatacagactacacaggtgatttggagcatccaaaagtaactcaagaagatgtagattat
ctacttggcattgtcaacaaccgcttcccagaatccaacatcaccattgatgatatcgaa
agcagctgggcaggtcttcgtccattgattgcagggaacagtgcctctgactataatggt
ggaaataacggtaccatcagtgatgaaagctttgacaacttgattgcgactgttgaatct
tatctctccaaagaaaaaacacgtgaagatgttgagtctgctgtcagcaagcttgaaagt
agcacatctgagaaacatttggatccatctgcagtttctcgtgggtctagcttggatcgt
gatgacaatggtcttttgactcttgctggcggtaaaatcacagactaccgtaagatggct
gaaggagctatggagcgcgtggttgacatcctcaaagcagaatttgaccgtagctttaaa
ttgatcaattctaaaacttaccctgtttcaggtggagaattgaacccagcaaatgtggat
tcagaaatcgaagcctttgcgcaacttggagtatcacgtggtttggatagcaaggaagct
cactatctggcaaatctttacggttcaaatgcaccgaaagtctttgcacttgctcacagc
ttggaacaagcgccaggactcagcttggcagatactttgtcccttcactatgcaatgcgc
aacgagttggctcttagccccgttgacttccttcttcgtcgtaccaaccatatgctcttt
atgcgtgatagcttggatagcatcgttgagccagttttggatgaaatgggacgattctat
gactggacagaagaagaaaaagcaacttaccgtgctgatgtcgaagcagctctcgctaac
aacgatttagcagaattaaaaaattaa

DBGET integrated database retrieval system