KEGG   Streptococcus pneumoniae CGSP14 (serotype 14): SPCG_2154Help
Entry
SPCG_2154         CDS       T00690                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
spw  Streptococcus pneumoniae CGSP14 (serotype 14)
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spw00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    SPCG_2154 (glpK)
Enzymes [BR:spw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SPCG_2154 (glpK)
Exosome [BR:spw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SPCG_2154 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2152893..2154401)
Genome map
AA seq 502 aa AA seqDB search
MSQEKYIMAIDQGTTSSRAIIFNKKGEKVSSSQKEFTQIFPQAGWVEHNANEIWNSVQSV
IAGAFIESGVKPNQIEAIGITNQRETTVVWDKKTGLPIYNAIVWQSRQTAPLAEQLKSQG
YVEKFHEKTGLIIDAYFSATKVRWILDHVEGAQERAEKGELLFGTIDTWLVWKLTDGAAH
VTDYSNAARTMLYNIKELKWDDEILEILNIPKAILPEVRSNSEIYGKTAPFHFYGGEVPI
SGMAGDQQAALFGQLAFEPGMVKNTYGTGSFIIMNTGEEMQLSENNLLTTIGYGINGKVY
YALEGSIFIAGSAIQWLRDGLRMVENSPESEKYARDSHNNDEVYVVPAFTGLGAPYWNQN
ARGSVFGLTRGTSKEDFIKATLQSIAYQVRDIIDTMQVDTQTAIQVLKVDGGAAMNNFLM
QFQADILGIDIARAKNLETTALGAAFLAGLSVGYWKDLDELKLLNETGELFEPSMNESRK
EQLYKGWKKAVKATQVFAEVDD
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaagaaaaatacatcatggccattgaccagggaactacaagttctcgtgccatc
attttcaacaaaaaaggggaaaaggttagctcgagtcaaaaagagtttacccagattttc
cctcaggcaggttgggttgagcacaatgccaatgaaatttggaactctgttcagtcagtt
attgcgggtgctttcatcgaaagtggtgtcaagccaaatcaaatcgaggcaatcgggatt
accaaccaacgtgaaacaacggttgtctgggataagaaaacaggacttcctatctacaat
gctatcgtttggcagtcacgccagacagcacctttggctgagcaactaaaaagccaaggt
tatgtggaaaaattccatgaaaagactggtttgattattgatgcttacttctctgctacc
aaggttcgttggattttggatcatgtagaaggcgctcaagagcgagcagaaaaaggggaa
ttgctctttggtactatcgatacttggttggtttggaaattgactgacggtgcggctcac
gtgactgactactcaaatgcagctcgtaccatgctttataacattaaagaactcaaatgg
gatgatgaaattttggaaatccttaacattccgaaggctatacttccagaagttcgttct
aactccgaaatctacggcaagacagctccattccatttctacggtggagaggtgccaatc
tcaggtatggctggggaccaacaagcagccctctttggacagttggcttttgagccaggt
atggttaagaatacttatggaacaggctctttcatcatcatgaatactggggaagagatg
cagttgtctgaaaacaacctcttgacaaccattggttacggaatcaacggtaaggtttat
tatgccttggaaggttctatcttcatcgcaggaagtgctattcagtggcttcgtgacggt
cttcgcatggttgaaaattcaccagaatctgaaaaatacgctcgtgattctcacaacaac
gatgaagtttatgtcgttccagcctttacaggtctaggcgctccatactggaaccaaaat
gctcgtggttccgtctttggtttgactcgtggaacaagcaaagaagactttatcaaggcg
actttgcaatctattgcttatcaagtgcgtgacatcatcgacaccatgcaagtggatact
cagaccgccattcaagtactgaaggtggatggtggtgcagccatgaacaacttcctcatg
caattccaggcggatattttaggcattgacattgcacgtgctaaaaacttggaaacaaca
gctctaggagcggccttcctagcaggtttgtcagtagggtactggaaagacttggacgag
ttgaaactcttgaacgagacaggagaactctttgagccatctatgaatgaatctcgcaag
gaacaactctacaagggctggaagaaggctgtgaaagcaactcaagtctttgcggaagta
gacgactaa

DBGET integrated database retrieval system