KEGG   Streptococcus pneumoniae G54 (serotype 19F): SPG_0062Help
Entry
SPG_0062          CDS       T00734                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
spx  Streptococcus pneumoniae G54 (serotype 19F)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spx00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SPG_0062
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SPG_0062
Enzymes [BR:spx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SPG_0062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(58104..62042)
Genome map
AA seq 1312 aa AA seqDB search
MKHEKQQRFSIRKYAVGAASVLIGFAFQAQTVAADGVTPTTTENQPTIHTVSDSPQSSEN
RTEETPKAVLQPEAPKTVETETPATDKVASLPKTEEKPQEEVSSTPSDKAEVVTPTSAEK
ETANKKAEEASPKKEEAKEVDSKESNTDKTDKDKPAKKDEAKAEADKPETEAGKERAATV
NEKLAKKKIVSIDAGRKYFSPEQLKEIIDKAKHYGYTDLHLLVGNDGLRFMLDDMSITAN
GKTYASDDVKRAIEKGTNDYYNDPNGNHLTESQMTDLINYAKDKGIGLIPTVNSPGHMDA
ILNAMKELGIQNPNFSYFGKKSARTVDLDNEQAVAFTKALIDKYAAYFAKKTEIFNIGLD
EYANDATDAKGWSVLQADKYYPNEGYPVKGYEKFIAYANDLARIVKSHGLKPMAFNDGIY
YNSDTSFGSFDKDIIVSMWTGGWGGYDVASSKLLAEKGHQILNTNDAWYYVLGRNADGQG
WYNLDQGLNGIKNTPITSVPKTEGADIPIIGGMVAAWADTPSARYSPSRLFKLMRHFANA
NAEYFAADYESAEQALNEVPKDLNRYTAESVTAVKEAEKAIRSLDSNLSRAQQDTIDQAI
AKLQETVNNLTLTPEALKEEEAKREVEKLAKNKVISIDAGRKYFTLNQLKRIVDKASELG
YSDVHLLLGNDGLRFLLDDMTITANGKTYASDDVKKAIIEGTKAYYDDPNGTALTQAEVT
ELIEYAKSKDIGLIPAINSPGHMDAMLVAMEKLGIKNPQAHFDKVSKTTMDLKNEEAMNF
VKALIGKYMDFFAGKTKIFNFGTDEYANDATSAQGWYYLKWYQLYGKFAEYANTLAAMAK
ERGLQPMAFNDGFYYEDKDDVQFDKDVLISYWSKGWWGYNLASPQYLASKGYKFLNTNGD
WYYILGQKPEDGGGFLKKAIENTGKTPFNQLASTKYPEVDLPTVGSMLSIWADRPSAEYK
EEEIFELMTAFADHNKDYFRANYNALREELAKIPTNLEGYSKESLEALDAAKTALNYNLN
RNKQAELDTLVANLKAALQGLKPAATHSGSLDENEVAANVETRPELITRTEEIPFEVIKK
ENPNLPAGQENIITAGVKGERTHYISVLTENGKTTETVLDSQVTKEVINQVVEVGAPVTH
KGDESGLAPTTEVKPRLDIQKEEIPFTTVTRENPLLLKGKTQVITKGVNGHRSNFYSVST
SADGKEVKTLVNSVVAQEAVTQIVEVGTMVTHVGDENGQAAIAEEKPKLEIPSQPAPSTA
PAEESKALPQDPAPVVTEKKLPETGTHDSAGLVVAGLMSTLAAYGLTKRKED
NT seq 3939 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatgaaaaacaacagcgtttttctattcgtaaatacgctgtaggagcagcttct
gttctaattggatttgccttccaagcacagactgttgcagccgatggagttactcctact
actacagaaaaccaaccgaccatccatacggtttctgattcccctcaatcatccgaaaat
cggactgaggaaacacctaaagcagtgcttcaaccagaagctccaaaaactgtagaaaca
gaaactccagctactgataaggtagctagtcttccaaaaacagaagaaaaaccacaagag
gaagttagttcaactcctagtgataaagcagaagtggtaactccaacttctgctgaaaaa
gaaactgctaataaaaaggcagaagaagctagccctaaaaaggaagaagcgaaagaggtt
gattctaaagagtcaaatacagacaagactgacaaggataaaccagctaaaaaagatgaa
gcgaaagcagaggctgacaaaccggaaacagaggcaggaaaggaacgtgctgcaactgta
aatgaaaaactagcgaaaaagaaaattgtttctattgatgctggacgtaaatatttctca
ccagaacaactcaaggaaatcatcgataaagcgaaacattatggctacactgatttacac
ctattagtcggaaatgatggactccgtttcatgttggacgatatgagcatcacagctaac
ggcaagacctatgccagtgacgatgtcaaacgcgccattgaaaaaggtacaaatgattat
tacaacgatccaaacggcaatcacttaacagaaagtcaaatgacagatctgattaactat
gccaaagataaaggtatcggtctcattccgacagtaaatagtcctggacacatggatgcg
attctcaatgccatgaaagaattgggaatccaaaaccctaactttagctattttgggaag
aaatcagcccgtactgtcgatcttgacaacgaacaagctgtcgcttttacaaaagccctt
atcgacaagtatgctgcttatttcgcgaaaaagactgaaatcttcaacatcggacttgat
gaatatgccaatgatgcgacagatgctaaaggttggagtgtgcttcaagctgataaatac
tatccaaacgaaggctaccctgtaaaaggctatgaaaaatttattgcctacgccaatgac
ctcgctcgtattgtaaaatcgcacggtctcaaaccaatggcttttaacgacggtatctac
tacaatagcgacacaagctttggtagttttgacaaagacatcatcgtttctatgtggact
ggtggttggggaggctacgatgtcgcttcttctaaactactagctgaaaaaggtcaccaa
atccttaataccaatgatgcttggtactacgttcttggacgaaacgctgatggccaaggc
tggtacaatctcgatcaggggctcaatggtattaaaaacacaccaatcacttctgtacca
aaaacagaaggagctgatatcccaatcatcggtggtatggtagctgcttgggctgacact
ccatctgcacgttattcaccatcacgcctcttcaaactcatgcgtcattttgcaaatgcc
aacgctgaatacttcgcagctgattatgaatctgcagagcaagcacttaacgaggtacca
aaagacctgaaccgttatactgcagaaagcgtcacggccgtaaaagaagctgaaaaagct
attcgctctctcgatagcaaccttagccgtgcccaacaagatacgattgatcaagccatt
gctaaacttcaagaaactgtcaacaacttgaccctcacgcctgaagctctaaaagaagaa
gaagctaaacgtgaggttgaaaaacttgccaaaaacaaggtaatctcaatcgatgctgga
cgcaaatactttactctgaaccagctcaaacgcatcgtagacaaggccagtgagctcgga
tattctgatgtccatctccttctaggaaatgacggacttcgctttctactcgatgatatg
accattactgccaacggaaaaacctatgctagtgatgacgttaaaaaagctattatcgaa
ggaactaaagcttactacgacgatccaaacggtactgcactaacacaggcagaagtaaca
gagctaattgaatacgctaaatctaaggacatcggtctcatcccagctattaacagtcca
ggtcacatggatgctatgctggttgccatggaaaaattaggtattaaaaatcctcaagcc
cactttgataaagtttcaaaaacaactatggacttgaaaaacgaagaagcgatgaacttt
gtaaaagccctcatcggtaaatacatggacttctttgcaggtaaaacaaagattttcaac
tttggtactgacgaatacgccaacgatgcgactagtgcccaaggctggtactacctcaag
tggtatcaactctatggcaaatttgccgaatatgccaacaccctcgcagctatggccaaa
gaaagagggcttcaaccaatggccttcaacgatggcttctactatgaagacaaggacgat
gttcagtttgacaaagatgtcttgatttcttactggtctaaaggctggtggggatataac
ctcgcatcacctcaatacctagcaagcaaaggctataaattcttgaataccaacggtgac
tggtactacattcttggtcaaaaaccagaagatggtggtggtttcctcaagaaagctatt
gagaatactggaaaaacaccattcaatcaactagcttctaccaaatatcctgaagtagat
cttccaacagtcggaagtatgctttcaatctgggcagatagaccaagcgctgagtacaag
gaagaggaaatctttgaactcatgactgcctttgcagaccacaacaaagactacttccgt
gctaattataatgctctccgcgaagaattagctaaaattcctacaaacttagaaggatat
agtaaagaaagtcttgaggcccttgacgcagctaaaacagctctaaattacaacctcaac
cgtaataaacaagctgagcttgacacacttgtagccaacctaaaagccgctcttcaaggc
ctcaaaccagctgcaactcattcaggaagcctggatgaaaatgaagtggctgccaatgtt
gaaaccagaccagaactcatcacaagaactgaagaaattccatttgaagttatcaagaaa
gaaaatcctaacctcccagctggtcaggaaaatattatcacagcaggagtcaaaggtgaa
cgaactcattacatctctgtactcactgaaaatggaaaaacaacagaaacagtccttgat
agccaggtaaccaaagaagttataaaccaagtggttgaagttggcgctcctgtaactcac
aagggtgatgaaagtggtcttgcaccaactactgaggtaaaacctagactggatatccaa
aaagaagaaattccatttaccacagtgactcgtgaaaatccactcttactcaaaggaaaa
acacaagtcattactaagggcgtcaatggacatcgtagcaacttctactctgtgagcact
tctgccgatggtaaggaagtgaaaacacttgtaaatagtgtcgtagcacaggaagccgtt
actcaaatagtcgaagtcggaactatggtaacacatgtaggcgatgaaaacggacaagcc
gctattgctgaagaaaaaccaaaactagaaatcccaagccaaccagctccatcaactgct
cccgctgaggaaagcaaagctcttcctcaagatccagctcctgtggtaacagagaaaaaa
cttcctgaaacaggaactcacgattctgcaggactagtagtcgcaggactcatgtccaca
ctagcagcctatggactcactaaaagaaaagaagactaa

DBGET integrated database retrieval system