KEGG   Streptococcus pneumoniae G54 (serotype 19F): SPG_0274Help
Entry
SPG_0274          CDS       T00734                                 

Gene name
sulA
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
spx  Streptococcus pneumoniae G54 (serotype 19F)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SPG_0274 (sulA)
Enzymes [BR:spx01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SPG_0274 (sulA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
265179..266153
Genome map
AA seq 324 aa AA seqDB search
MMKILEGVTDMSSKANHAKTVICGIINVTPDSFSDGGKFFALEQALQQARKLIAEGASML
DIGGESTRPGSSYVEIEEEIQRVVPVIKAIRKESDVLISIDTWKSQVAEAALAAGADLVN
DITGLMGDEKMAHVVAEARAQVVIMFNPVMARPQHPSSLIFPHFGFGQAFTEEELADFET
LPIEELMEAFFERALARAAEAGIAPENILLDPGIGFGLTKKENLLLLRDLDKLHQKGYPI
FLGVSRKRFVINILEENGFEVNPETELGFRNRDTASAHVTSIAARQGVEVVRVHDVASHR
MAVEIASAIRLADEAENLDLKQYK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaatccttgagggagtgaccgatatgtcaagtaaagccaatcatgcaaagaca
gttatttgcggaattatcaatgtaaccccagactccttttcggacggtggtaaatttttt
gctcttgagcaggcactccagcaggctcgtaaattgatagcagaaggagccagtatgctc
gatatcggcggagaatcgactcggccgggcagtagctatgttgagatagaagaggaaatc
cagcgtgttgttccagtgatcaaagcgattcgcaaggaaagtgatgtcctcatctctatt
gatacttggaagagtcaagtagcagaggctgctttggctgctggtgccgatctagtcaat
gatatcactggtcttatgggtgatgagaaaatggctcatgtggtagctgaagcgagagcg
caagtggtcatcatgtttaatccagttatggcgcgacctcagcaccctagctcgctcatc
ttccctcattttggttttggtcaagcttttacagaggaagagttagctgactttgaaaca
ttgccaatcgaagaattgatggaggctttctttgaacgagcactagcgagagcggcagaa
gctggtattgcaccagaaaatatcctgttggatccaggaattggctttggtctgaccaag
aaagaaaatctgcttcttttacgggacctggataaactacatcagaagggctatccaatc
tttctcggagtgtcgcgcaagcgatttgtcatcaatatcctagaggagaatggttttgaa
gtcaatcctgagacagagcttggtttccgaaatcgggacacggcttcggctcatgtaact
agtatcgctgcgagacagggtgtagaagtggtacgcgtgcatgacgtagctagtcacagg
atggcagttgaaattgcctctgccattcgtctggctgatgaagcggaaaatttagattta
aaacaatataaataa

DBGET integrated database retrieval system