KEGG   Streptococcus pneumoniae G54 (serotype 19F): SPG_0276Help
Entry
SPG_0276          CDS       T00734                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
spx  Streptococcus pneumoniae G54 (serotype 19F)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SPG_0276 (folE)
Enzymes [BR:spx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     SPG_0276 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
267458..268012
Genome map
AA seq 184 aa AA seqDB search
MDTQKIEAAVKMIIEAVGEDANREGLQETPARVARMYQEIFSGLGQTAEEHLSKSFEIID
DNMVVEKDIFFHTMCEHHFLPFYGRAHIAYIPDGRVAGLSKLARTVEVYSKKPQIQERLN
IEVADALMDYLGAKGAFVVIEAEHMCMSMRGVRKPGTATLTTVARGLFETDKDLRDQAYR
LMGL
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggatacacaaaagattgaagcagctgtgaaaatgattatcgaggctgtaggagaggac
gctaatcgcgagggcttgcaggaaacacctgctcgtgtagcccgtatgtatcaagagatt
ttttcaggtcttggtcaaacagcagaggaacatttgtcaaaatcctttgaaattattgac
gataatatggtggtagaaaaggatatctttttccataccatgtgtgaacaccacttcttg
ccattttatggtagagcgcacattgcctacattccagatggtcgtgtggcaggcttgtct
aagctagcccgtacggttgaagtttattcgaaaaaaccacaaattcaagaacgtttgaat
atcgaagtggccgatgccttgatggactatctaggtgctaaaggagcctttgttgtcatt
gaggcggaacatatgtgtatgagtatgcgtggtgttagaaaaccaggcactgcaaccttg
acgacagtagctcgtggtctatttgaaacagataaggacctccgcgaccaagcttatcgt
ttaatggggctataa

DBGET integrated database retrieval system