KEGG   Streptococcus pneumoniae G54 (serotype 19F): SPG_0277Help
Entry
SPG_0277          CDS       T00734                                 

Gene name
sulD
Definition
bifunctional folate synthesis protein (EC:4.1.2.25 2.7.6.3)
Orthology
K13940  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:4.1.2.25 2.7.6.3]
Organism
spx  Streptococcus pneumoniae G54 (serotype 19F)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:spx00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
268055..268867
Genome map
AA seq 270 aa AA seqDB search
MDQLQIKDLEMFAYHGLFPSEKELGQKFVVSAILSYDMTKAATDLDLTASVHYGELCQQW
TTWFQETSEDLIETVAYKLVERTFESYPLVQEMKLELKKPWAPVHLSLDTCSVTIHRRKQ
RAFIALGSNMGDKQANLKQAIDKLRARGIHILKESSVLATEPWGGVEQDSFANQVVEVET
WLPAQDLLETLLAIESELGRVREVHWGPRLIDLDLLFVEDQILYTDDLILPHPYIAERLF
VLESLQEIAPHFIHPILKQPIRNLYDALKK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggatcaactgcagattaaggatttggaaatgtttgcctatcatggtctttttcctagt
gagaaagaattggggcagaaatttgtcgtttcagccatcctatcctatgatatgaccaag
gcagctacagacttggatttaacagcctctgtccattacggagaattgtgtcagcagtgg
acgacttggtttcaggaaacgagtgaggatttgattgaaacggtagcctataaactggtg
gaacgtacctttgagtcttatcctcttgtccaagaaatgaagttggaactgaaaaaacct
tgggcaccggtgcatttgtcactagatacttgctcggtaaccattcatcgccgcaagcaa
cgagcctttatcgccctaggaagcaatatgggagataagcaagcaaacttgaagcaagcc
attgacaaactgcgagctcgtggcatccatattctcaaagagtccagtgtcttagcgacg
gagccttggggtggagtggagcaggatagctttgccaatcaagtggttgaggtggaaacc
tggctaccagcacaagacttgttagaaaccttgttagccattgagtcagagctgggacgg
gtgagagaagtgcattggggacctcgtttgattgatttggacttgctctttgtggaggac
cagatcctttatacagacgacctcatattgcctcatccttacatagcggaacgccttttt
gtccttgagtccttacaggaaattgcgcctcattttatccatccgatattaaaacaaccg
atccgcaacttgtatgatgctttgaaaaaatag

DBGET integrated database retrieval system