KEGG   Streptococcus pneumoniae G54 (serotype 19F): SPG_0326Help
Entry
SPG_0326          CDS       T00734                                 

Gene name
cpsM
Definition
dTDP-4-keto-6-deoxyglucose-3,5-epimerase RmlC
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
spx  Streptococcus pneumoniae G54 (serotype 19F)
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:spx00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:spx00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
316021..316617
Genome map
AA seq 198 aa AA seqDB search
MTDNFFGKTLAARKVEAIPGMLEFDIPVHGDNRGWFKENFQKEKMLPLGFPESFFAEGKL
QNNVSFSRKNVLRGLHAEPWDKYISVADGGKVLGSWVDLREGETFGNTYQTVIDASKGIF
VPRGVANGFQVLSDTVSYSYLVNDYWALELKPKYAFVNYADPSLGIEWENIAEAEVSEAD
KHHPLLKDVKPLKKEDLE
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgacagataattttttcggtaagacgcttgcggcacgcaaggttgaagctattccaggc
atgttggagtttgatatccccgttcatggagataatcgtggctggtttaaagaaaatttc
caaaaggaaaaaatgcttccacttggatttccagagtctttctttgcagaaggaaaattg
caaaacaatgtatccttctcacgtaaaaatgtccttcgaggtctccacgcagagccttgg
gataagtacatctctgtagcagatggagggaaagttctgggttcttgggttgatctacgc
gagggtgaaacctttgggaatacctatcagacagtgattgatgcgagtaagggaatcttt
gttcctcgaggcgtagctaatggcttccaagttttatcagatacagtgtcatatagctat
ctggtcaatgattactgggctcttgaactcaaacccaagtatgcctttgtgaactacgct
gatccaagccttggtattgaatgggaaaatattgcagaagcagaggtttcagaagcagac
aaacatcatccactacttaaggatgtaaaacctttgaaaaaagaagatttggaataa

DBGET integrated database retrieval system