KEGG   Streptococcus pneumoniae G54 (serotype 19F): SPG_0326Help
Entry
SPG_0326          CDS       T00734                                 

Gene name
cpsM
Definition
dTDP-4-keto-6-deoxyglucose-3,5-epimerase RmlC
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
spx  Streptococcus pneumoniae G54 (serotype 19F)
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spx00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SPG_0326 (cpsM)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SPG_0326 (cpsM)
Enzymes [BR:spx01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     SPG_0326 (cpsM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
316021..316617
Genome map
AA seq 198 aa AA seqDB search
MTDNFFGKTLAARKVEAIPGMLEFDIPVHGDNRGWFKENFQKEKMLPLGFPESFFAEGKL
QNNVSFSRKNVLRGLHAEPWDKYISVADGGKVLGSWVDLREGETFGNTYQTVIDASKGIF
VPRGVANGFQVLSDTVSYSYLVNDYWALELKPKYAFVNYADPSLGIEWENIAEAEVSEAD
KHHPLLKDVKPLKKEDLE
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgacagataattttttcggtaagacgcttgcggcacgcaaggttgaagctattccaggc
atgttggagtttgatatccccgttcatggagataatcgtggctggtttaaagaaaatttc
caaaaggaaaaaatgcttccacttggatttccagagtctttctttgcagaaggaaaattg
caaaacaatgtatccttctcacgtaaaaatgtccttcgaggtctccacgcagagccttgg
gataagtacatctctgtagcagatggagggaaagttctgggttcttgggttgatctacgc
gagggtgaaacctttgggaatacctatcagacagtgattgatgcgagtaagggaatcttt
gttcctcgaggcgtagctaatggcttccaagttttatcagatacagtgtcatatagctat
ctggtcaatgattactgggctcttgaactcaaacccaagtatgcctttgtgaactacgct
gatccaagccttggtattgaatgggaaaatattgcagaagcagaggtttcagaagcagac
aaacatcatccactacttaaggatgtaaaacctttgaaaaaagaagatttggaataa

DBGET integrated database retrieval system