KEGG   Streptococcus pneumoniae G54 (serotype 19F): SPG_0392Help
Entry
SPG_0392          CDS       T00734                                 

Gene name
accD
Definition
acetyl-CoA carboxylase subunit beta
Orthology
K01963  
acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2]
Organism
spx  Streptococcus pneumoniae G54 (serotype 19F)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:spx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPG_0392 (accD)
   01212 Fatty acid metabolism
    SPG_0392 (accD)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SPG_0392 (accD)
   00640 Propanoate metabolism
    SPG_0392 (accD)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    SPG_0392 (accD)
  Metabolism of terpenoids and polyketides
   00253 Tetracycline biosynthesis
    SPG_0392 (accD)
Enzymes [BR:spx01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     SPG_0392 (accD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
383123..383989
Genome map
AA seq 288 aa AA seqDB search
MALFSKKDKYIRINPNRSVREKPQAKPEVPDELFSQCPGCKHTIYQKDLGSERICPHCSY
TFRISAQERLALTIDMGTFKELFTGIESKDPLHFPGYQKKLASMREKTGLHEAVVTGTAL
IKGQTVALGIMDSNFIMASMGTVVGEKITRLFEYATVEKLPVVLFTASGGARMQEGIMSL
MQMAKISAAVKRHSNAGLFYLTILTDPTTGGVTASFAMEGDIILAEPQSLVGFAGRRVIE
NTVRESLPEDFQKAEFLLEHGFVDAIVKRRDLPDTIASLVRLHGGSPR
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggctctatttagtaaaaaagataagtatattcgaatcaatcccaatcgttcggttagg
gaaaaacctcaagctaagccagaggttccagatgaattattttcccagtgtccaggctgt
aagcataccatctatcagaaggatctgggaagtgaacgtatctgtccgcactgtagctat
acctttcgtatttctgcccaagaacgcttggctttgacgattgatatgggaaccttcaaa
gaattgtttacagggattgaaagcaaggatcccttgcatttccctggttaccaaaagaaa
ctggcatctatgcgtgaaaaaacaggtctgcatgaagccgttgtgacaggaactgctctt
attaaaggtcagactgtggctcttgggattatggattctaactttatcatggcttctatg
ggtacggttgtaggtgaaaaaatcactcgtttgtttgagtatgcgactgtcgaaaaattg
ccagttgtcctattcacagcctctggtggagcccgtatgcaggaaggaatcatgagtctc
atgcagatggctaagatctctgcggcggttaaacgtcattcaaatgctggtctcttttac
ctgaccattttgacagatccaacgactggtggtgtgacagcttctttcgctatggaaggc
gatatcattctggctgaaccacagagcttggttggttttgctgggcgtcgtgtgattgaa
aatacggttcgtgaaagcttgcctgaggatttccaaaaggcagaattcctattagaacat
ggctttgtggatgctattgtcaaaagaagagacttaccagatacgattgctagcctagtc
agattgcatggagggagtcctagatga

DBGET integrated database retrieval system