KEGG   Streptococcus pneumoniae G54 (serotype 19F): SPG_0392Help
Entry
SPG_0392          CDS       T00734                                 

Gene name
accD
Definition
(GenBank) acetyl-CoA carboxylase beta subunit
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Organism
spx  Streptococcus pneumoniae G54 (serotype 19F)
Pathway
spx00061  Fatty acid biosynthesis
spx00620  Pyruvate metabolism
spx00640  Propanoate metabolism
spx01100  Metabolic pathways
spx01110  Biosynthesis of secondary metabolites
spx01120  Microbial metabolism in diverse environments
spx01130  Biosynthesis of antibiotics
spx01200  Carbon metabolism
spx01212  Fatty acid metabolism
Module
spx_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:spx00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SPG_0392 (accD)
   00640 Propanoate metabolism
    SPG_0392 (accD)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    SPG_0392 (accD)
Enzymes [BR:spx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     SPG_0392 (accD)
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     SPG_0392 (accD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carboxyl_trans IBR Zn_Tnp_IS91 Cys_rich_CPCC
Motif
Other DBs
NCBI-ProteinID: ACF55164
Position
383123..383989
Genome map
AA seq 288 aa AA seqDB search
MALFSKKDKYIRINPNRSVREKPQAKPEVPDELFSQCPGCKHTIYQKDLGSERICPHCSY
TFRISAQERLALTIDMGTFKELFTGIESKDPLHFPGYQKKLASMREKTGLHEAVVTGTAL
IKGQTVALGIMDSNFIMASMGTVVGEKITRLFEYATVEKLPVVLFTASGGARMQEGIMSL
MQMAKISAAVKRHSNAGLFYLTILTDPTTGGVTASFAMEGDIILAEPQSLVGFAGRRVIE
NTVRESLPEDFQKAEFLLEHGFVDAIVKRRDLPDTIASLVRLHGGSPR
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggctctatttagtaaaaaagataagtatattcgaatcaatcccaatcgttcggttagg
gaaaaacctcaagctaagccagaggttccagatgaattattttcccagtgtccaggctgt
aagcataccatctatcagaaggatctgggaagtgaacgtatctgtccgcactgtagctat
acctttcgtatttctgcccaagaacgcttggctttgacgattgatatgggaaccttcaaa
gaattgtttacagggattgaaagcaaggatcccttgcatttccctggttaccaaaagaaa
ctggcatctatgcgtgaaaaaacaggtctgcatgaagccgttgtgacaggaactgctctt
attaaaggtcagactgtggctcttgggattatggattctaactttatcatggcttctatg
ggtacggttgtaggtgaaaaaatcactcgtttgtttgagtatgcgactgtcgaaaaattg
ccagttgtcctattcacagcctctggtggagcccgtatgcaggaaggaatcatgagtctc
atgcagatggctaagatctctgcggcggttaaacgtcattcaaatgctggtctcttttac
ctgaccattttgacagatccaacgactggtggtgtgacagcttctttcgctatggaaggc
gatatcattctggctgaaccacagagcttggttggttttgctgggcgtcgtgtgattgaa
aatacggttcgtgaaagcttgcctgaggatttccaaaaggcagaattcctattagaacat
ggctttgtggatgctattgtcaaaagaagagacttaccagatacgattgctagcctagtc
agattgcatggagggagtcctagatga

DBGET integrated database retrieval system