KEGG   Streptococcus pneumoniae G54 (serotype 19F): SPG_0609Help
Entry
SPG_0609          CDS       T00734                                 

Gene name
gki
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
spx  Streptococcus pneumoniae G54 (serotype 19F)
Pathway
spx00010  Glycolysis / Gluconeogenesis
spx00052  Galactose metabolism
spx00500  Starch and sucrose metabolism
spx00520  Amino sugar and nucleotide sugar metabolism
spx00521  Streptomycin biosynthesis
spx01100  Metabolic pathways
spx01110  Biosynthesis of secondary metabolites
spx01120  Microbial metabolism in diverse environments
spx01130  Biosynthesis of antibiotics
spx01200  Carbon metabolism
Module
spx_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
spx_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:spx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPG_0609 (gki)
   00052 Galactose metabolism
    SPG_0609 (gki)
   00500 Starch and sucrose metabolism
    SPG_0609 (gki)
   00520 Amino sugar and nucleotide sugar metabolism
    SPG_0609 (gki)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SPG_0609 (gki)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SPG_0609 (gki)
Enzymes [BR:spx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SPG_0609 (gki)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N
Motif
Other DBs
NCBI-ProteinID: ACF55457
Position
605369..606346
Genome map
AA seq 325 aa AA seqDB search
MKKENMMSQKIIGIDLGGTSIKFAILTTAGEIQGKWSIKTNILDEGSHIVDDMIESIQHR
LDLLGLAAADFQGIGMGSPGVVDRDKGTVIGAYNLNWKTLQPIKQKIEKALGIPFFIDND
ANVAALGERWMGAGDNQPDVVFMTLGTGVGGGIVAEGKLLHGVAGAAGELGHITVDFDQP
ISCTCGKKGCLETVASATGIVNLTRRYADEYEGDAALKRLIDNGEEVTAKTVFDLAKEGD
DLALIVYRNFSRYLGIACANIGSILNPSTIVIGGGVSAAGEFLLQGVQKVYDENSFPQVR
TSTKLALATLGNDAGVIGAASLVLQ
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaggagaatatgatgagtcaaaagattattgggattgaccttggtggaacttct
atcaaatttgcaatcttaacaacagcaggagaaatccaaggaaaatggtcaatcaagacc
aacattttggatgagggaagtcatatcgttgatgatatgattgagtctattcaacatcgt
ttggacttgcttggattggcagcagcggacttccaaggcattggaatgggatcaccaggt
gtggttgaccgtgacaaagggactgttatcggtgcctacaacttgaactggaaaaccctt
caaccaatcaaacaaaagattgaaaaagctttgggcattccatttttcatcgataatgat
gccaacgtagcagctcttggtgagcgctggatgggtgctggagataaccaaccagacgtt
gtctttatgacactcggtactggtgttggtggtggtattgtcgcagaaggcaaattgctt
catggtgttgctggtgcagcaggtgaacttggtcatatcactgttgactttgaccaacca
atctcatgtacttgtggtaaaaaaggctgccttgagacagttgcttcagcaacagggatt
gtcaacttgactcgtcgctatgccgatgaatacgaaggcgatgcagccttgaaacgcctg
attgataacggagaagaagtaactgctaagactgtctttgatctcgcaaaagaaggagac
gaccttgctttgattgtttaccgtaacttctcacgttacttgggaatcgcttgtgctaac
attggttcaatcctaaacccatcaacaatcgtcatcggtggtggtgtgtcagctgcggga
gaattccttctacaaggtgttcaaaaagtttacgatgaaaatagtttcccacaagtacgc
acatctactaaattagctcttgcaactctaggaaatgacgctggagttatcggagcagca
tcacttgtattgcaataa

DBGET integrated database retrieval system