KEGG   Streptococcus pneumoniae G54 (serotype 19F): SPG_0609Help
Entry
SPG_0609          CDS       T00734                                 

Gene name
gki
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
spx  Streptococcus pneumoniae G54 (serotype 19F)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:spx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPG_0609 (gki)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPG_0609 (gki)
   00052 Galactose metabolism
    SPG_0609 (gki)
   00500 Starch and sucrose metabolism
    SPG_0609 (gki)
   00520 Amino sugar and nucleotide sugar metabolism
    SPG_0609 (gki)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SPG_0609 (gki)
   00524 Butirosin and neomycin biosynthesis
    SPG_0609 (gki)
Enzymes [BR:spx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SPG_0609 (gki)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
605369..606346
Genome map
AA seq 325 aa AA seqDB search
MKKENMMSQKIIGIDLGGTSIKFAILTTAGEIQGKWSIKTNILDEGSHIVDDMIESIQHR
LDLLGLAAADFQGIGMGSPGVVDRDKGTVIGAYNLNWKTLQPIKQKIEKALGIPFFIDND
ANVAALGERWMGAGDNQPDVVFMTLGTGVGGGIVAEGKLLHGVAGAAGELGHITVDFDQP
ISCTCGKKGCLETVASATGIVNLTRRYADEYEGDAALKRLIDNGEEVTAKTVFDLAKEGD
DLALIVYRNFSRYLGIACANIGSILNPSTIVIGGGVSAAGEFLLQGVQKVYDENSFPQVR
TSTKLALATLGNDAGVIGAASLVLQ
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaggagaatatgatgagtcaaaagattattgggattgaccttggtggaacttct
atcaaatttgcaatcttaacaacagcaggagaaatccaaggaaaatggtcaatcaagacc
aacattttggatgagggaagtcatatcgttgatgatatgattgagtctattcaacatcgt
ttggacttgcttggattggcagcagcggacttccaaggcattggaatgggatcaccaggt
gtggttgaccgtgacaaagggactgttatcggtgcctacaacttgaactggaaaaccctt
caaccaatcaaacaaaagattgaaaaagctttgggcattccatttttcatcgataatgat
gccaacgtagcagctcttggtgagcgctggatgggtgctggagataaccaaccagacgtt
gtctttatgacactcggtactggtgttggtggtggtattgtcgcagaaggcaaattgctt
catggtgttgctggtgcagcaggtgaacttggtcatatcactgttgactttgaccaacca
atctcatgtacttgtggtaaaaaaggctgccttgagacagttgcttcagcaacagggatt
gtcaacttgactcgtcgctatgccgatgaatacgaaggcgatgcagccttgaaacgcctg
attgataacggagaagaagtaactgctaagactgtctttgatctcgcaaaagaaggagac
gaccttgctttgattgtttaccgtaacttctcacgttacttgggaatcgcttgtgctaac
attggttcaatcctaaacccatcaacaatcgtcatcggtggtggtgtgtcagctgcggga
gaattccttctacaaggtgttcaaaaagtttacgatgaaaatagtttcccacaagtacgc
acatctactaaattagctcttgcaactctaggaaatgacgctggagttatcggagcagca
tcacttgtattgcaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system