KEGG   Streptococcus pneumoniae G54 (serotype 19F): SPG_0857Help
Entry
SPG_0857          CDS       T00734                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
spx  Streptococcus pneumoniae G54 (serotype 19F)
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:spx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SPG_0857
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SPG_0857
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    SPG_0857
Enzymes [BR:spx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SPG_0857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
833503..834090
Genome map
AA seq 195 aa AA seqDB search
MKYKRIVFKVGTSSLTNEDGSLSRSKVKDITQQLAMLHEAGHELILVSSGAIAAGFGALG
FKKRPTKIADKQASAAVGQGLLLEEYTTNLLLRQIVSAQILLTQDDFVDKRRYKNAHQAL
SVLLNRGAIPIINENDSVVIDEVKVGDNDTLSAQVAAMVQADLLVLLTDVDGLYTGNPNS
ESKSQTLGENRDHQS
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacaaacggattgtctttaaggtgggtacttcttctctgacaaatgaggatgga
agtttatcacgtagtaaggtaaaggatattacccagcagttggctatgctgcacgaggct
ggtcatgagttgattttggtgtcttcaggtgccattgcggctggttttggagccttagga
tttaaaaagcgtccgactaaaattgctgataaacaggcttcagcagcggtagggcagggg
cttttgttggaagaatatacaaccaatcttctcttgcgtcaaatcgtttctgcacaaatc
ttgctgacccaagatgactttgtggataagcgtcgttataaaaatgcccatcaggctttg
tcggttttgctcaaccgtggggcaattcctatcatcaatgagaatgatagtgtcgttatt
gatgaggtcaaggttggggacaatgacactctaagtgcccaagtagcggcgatggtccaa
gcagaccttttggttctcttgacagatgtggacggtctctatactggaaatcctaattca
gaatccaagagccaaacgcttggagagaatcgagaccatcaatcgtga

DBGET integrated database retrieval system