KEGG   Streptococcus pneumoniae G54 (serotype 19F): SPG_0857Help
Entry
SPG_0857          CDS       T00734                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
spx  Streptococcus pneumoniae G54 (serotype 19F)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:spx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SPG_0857
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SPG_0857
Enzymes [BR:spx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SPG_0857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
833503..834090
Genome map
AA seq 195 aa AA seqDB search
MKYKRIVFKVGTSSLTNEDGSLSRSKVKDITQQLAMLHEAGHELILVSSGAIAAGFGALG
FKKRPTKIADKQASAAVGQGLLLEEYTTNLLLRQIVSAQILLTQDDFVDKRRYKNAHQAL
SVLLNRGAIPIINENDSVVIDEVKVGDNDTLSAQVAAMVQADLLVLLTDVDGLYTGNPNS
ESKSQTLGENRDHQS
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacaaacggattgtctttaaggtgggtacttcttctctgacaaatgaggatgga
agtttatcacgtagtaaggtaaaggatattacccagcagttggctatgctgcacgaggct
ggtcatgagttgattttggtgtcttcaggtgccattgcggctggttttggagccttagga
tttaaaaagcgtccgactaaaattgctgataaacaggcttcagcagcggtagggcagggg
cttttgttggaagaatatacaaccaatcttctcttgcgtcaaatcgtttctgcacaaatc
ttgctgacccaagatgactttgtggataagcgtcgttataaaaatgcccatcaggctttg
tcggttttgctcaaccgtggggcaattcctatcatcaatgagaatgatagtgtcgttatt
gatgaggtcaaggttggggacaatgacactctaagtgcccaagtagcggcgatggtccaa
gcagaccttttggttctcttgacagatgtggacggtctctatactggaaatcctaattca
gaatccaagagccaaacgcttggagagaatcgagaccatcaatcgtga

DBGET integrated database retrieval system