KEGG   Streptococcus pneumoniae G54 (serotype 19F): SPG_0858Help
Entry
SPG_0858          CDS       T00734                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
spx  Streptococcus pneumoniae G54 (serotype 19F)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:spx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SPG_0858
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SPG_0858
Enzymes [BR:spx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SPG_0858
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
834062..834613
Genome map
AA seq 183 aa AA seqDB search
MERIETINREIIDMAGGAGSSNGTGGMLTKIKAATIATESGVPVYICSSLKSDSMIEAAE
ETEDGSYFVAQEKGLRTQKQWLAFYAQSQGSIWVDKGAAEALSQHGKSLLLSGIVEAEGV
FSYGDIVTVFDKESGKSLGKGRVQFGASALEDMLRSQKAKGVLIYRDDWISITPEIQLLF
TEF
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
ttggagagaatcgagaccatcaatcgtgagattattgatatggctggtggagctggttcg
tcaaacggaactgggggtatgttaaccaaaatcaaggctgcaactatcgcgacggaatca
ggagttcctgtttatatctgctcatccttgaaatcagattccatgattgaggcggcagag
gagaccgaggatggttcttactttgttgctcaagagaaggggcttcgtacccagaaacaa
tggcttgccttctatgctcagagtcaaggttctatttgggttgataaaggggctgcggaa
gctctctctcaacatggaaagagtcttctcttatctggtatcgttgaagcagaaggagtc
ttttcttacggtgatatcgtgacagtatttgacaaggaaagtggaaaatcacttggaaaa
ggacgcgtgcaatttggagcatctgctttggaggatatgttgcgttctcaaaaagccaag
ggtgtcttgatttaccgtgacgactggatttccattactcctgaaatccaactacttttt
acagaattttag

  All links  
No link information was found.   
DBGET integrated database retrieval system