KEGG   Streptococcus pneumoniae G54 (serotype 19F): SPG_0894Help
Entry
SPG_0894          CDS       T00734                                 

Gene name
fpg
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
spx  Streptococcus pneumoniae G54 (serotype 19F)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:spx00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    SPG_0894 (fpg)
Enzymes [BR:spx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     SPG_0894 (fpg)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     SPG_0894 (fpg)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
862973..863797
Genome map
AA seq 274 aa AA seqDB search
MPELPEVETVCRGLEKLIIGKKISSIEIRYPKMIKTDLEEFQRELPSQIIESMGRRGKYL
LFCLTDKVLISHLRMEGKYFYYPDQVPERKHAHVFFRFEDGGTLVYEDVRKFGTMELLVP
DLLDAYFISKKLGPEPSEQDFDLQVFQAALAKSKKPIKSHLLDQTLVAGLGNIYVDEVLW
RAQVHPARPSQTLTAEEATAIHDQTIAVLGQAVEKGGSTIRTYTNAFGEDGSMQDFHQVY
DKTGQECVRCGTIIEKIQLGGRGTHFCPNCQRRD
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattacctgaggttgaaaccgtttgtcgtggcttagaaaaattgattatagga
aagaagatttcgagtatagaaattcgctaccccaagatgattaagacggatttggaagag
tttcaaagggaattgcctagtcagattatcgagtcaatgggacgtcgtggaaaatatttg
cttttctgcctgacagacaaggtcttgatttcccatttgcggatggagggcaagtatttt
tattatccagaccaagtgcctgaacgcaagcatgcccatgttttcttccggtttgaagat
gggggcacgcttgtttatgaggatgtacgcaagtttggaaccatggaactcttggtgcct
gaccttttagacgcctactttatttctaaaaaattaggtcctgaaccaagcgaacaagac
tttgatttacaggtctttcaagctgcccttgccaagtccaaaaagcctatcaaatcccat
ctcctagaccagaccttggtagctggacttggcaatatctatgtggatgaggttctctgg
cgagctcaggttcatccagctagaccttcccagactttgacagcagaagaagcgactgcc
attcatgaccagaccattgctgttttgggccaggctgttgaaaaaggtggctccaccatt
cggacttataccaatgcctttggggaagatggaagcatgcaggactttcatcaggtctat
gataagactggtcaagaatgtgtacgctgtggtaccatcattgagaaaattcaactaggc
ggacgtggaacccacttttgtccaaactgtcaaaggagggactga

DBGET integrated database retrieval system