KEGG   Streptococcus pneumoniae G54 (serotype 19F): SPG_1078Help
Entry
SPG_1078          CDS       T00734                                 

Gene name
nrdF
Definition
ribonucleotide-diphosphate reductase subunit beta (EC:1.17.4.1)
Orthology
K00526  
ribonucleoside-diphosphate reductase beta chain [EC:1.17.4.1]
Organism
spx  Streptococcus pneumoniae G54 (serotype 19F)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:spx00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:spx00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1057182..1058144
Genome map
AA seq 320 aa AA seqDB search
METYYKAINWNAIEDVIDKSTWEKLTEQFWLDTRIPLSNDLDDWRKLSNKEKDLVGKVFG
GLTLLDTMQSETGVQALRADIRTPHEEAVFNNIQFMESVHAKSYSSIFSTLNTKAEIEEI
FEWTNTNPYLQKKAEIVNEIYLNGSPLEKKVASVFLETFLFYSGFFTPLYYLGNNKLANV
AEIIKLIIRDESVHGTYIGYKFQLGFNELPEEEQEKLKEWMYDLLYTLYENEEGYTESLY
DGVGWTEEVKTFLRYNANKALMNMGQDPLFPDSAEDVNPIVMNGISTGTSNHDFFSQVGN
GYLLGEVEAMQDDDYNYGLD
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggaaacttactacaaagccattaactggaatgccatcgaagatgtcatcgacaaatca
acttgggaaaaactgacggagcaattttggctcgatacacgtattcccttatcaaacgac
ttggatgactggagaaagctatctaacaaagagaaagacttggtcggaaaagtttttggt
ggtttaacccttcttgacactatgcaatctgaaactggggttcaagcccttcgcgcagac
atccgtacaccacatgaggaagctgttttcaataacatccaatttatggaatctgtccac
gctaaatcttactcatcaatcttttctaccttgaatactaaggctgagattgaagaaatt
ttcgaatggaccaataccaatccttacctacaaaagaaggctgagattgtcaacgaaatc
tacctaaacggcagcccacttgaaaagaaagttgccagcgtcttcctcgaaaccttcctc
ttctactctggtttcttcactcccctctactatctcggtaacaacaaactagccaacgtt
gcagaaatcattaaattgattattcgtgacgagtctgttcacggaacctacattggttac
aaattccaacttggtttcaatgaattgcctgaagaagagcaagaaaaactcaaagaatgg
atgtacgacctactctatactctttatgaaaatgaagaaggctacacagagagtctttat
gacggtgttggttggactgaagaggttaaaaccttccttcgctacaatgccaataaagct
ctcatgaacatgggacaagatccacttttcccagattcagctgaagatgtcaacccaatc
gttatgaacggtatttcaacaggaacttccaaccatgacttcttctctcaagtcggaaat
ggttaccttcttggcgaagttgaagccatgcaagacgatgactataactacggtttagac
taa

DBGET integrated database retrieval system