KEGG   Streptococcus pneumoniae G54 (serotype 19F): SPG_1171Help
Entry
SPG_1171          CDS       T00734                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
spx  Streptococcus pneumoniae G54 (serotype 19F)
Pathway
spx00240  Pyrimidine metabolism
spx00250  Alanine, aspartate and glutamate metabolism
spx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spx00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SPG_1171 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SPG_1171 (pyrB)
Enzymes [BR:spx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     SPG_1171 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ACF55584
UniProt: B5E514
Position
complement(1147455..1148378)
Genome map
AA seq 307 aa AA seqDB search
MSENQQALNHVVSMEDLTVDQVMKLIKRGIEFKNGAQLPYEDHPIVSNLFFEDSTRTHKS
FEVAEIKLGLERLDFDVKTSSVNKGETLYDTILTLSALGVDVCVIRHPEVDYYRELIASP
TITTSIINGGDGSGQHPSQSLLDLMTIYEEFGHFEDLKVAIAGDLDHSRVAKSNMQILKR
LGAELFFAGPEEWRSQEFADYGKFVTIDEIIDQVDVMMFLRVQHERHDSGAVFSKEDYHA
QHGLTQERYDRLKETAILMHPAPINRDVEIADHLVEAPKSRIVQQMTNGVFVRMAILESV
LASRNAN
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaaatcaacaagcattgaaccatgtggtgtccatggaagacctcactgtcgat
caagtaatgaaattgatcaagcgaggaattgagtttaaaaatggagcccagcttccctat
gaagaccatccgattgtttccaatctcttctttgaggattctacacggacacataagtcc
tttgaagtcgcagagattaaacttggattggaacgacttgactttgatgtgaagactagt
tcggttaataagggtgagacactttatgacaccattttgactctgtctgctttaggagtg
gatgtctgtgtgattcgccatccagaggtcgactactatagagaattgattgctagtcca
acgattacgacttccatcatcaatggtggagatggttcgggccaacaccctagccagagc
ttgcttgatttgatgaccatttatgaggaatttggccactttgaggatcttaaagttgct
attgcaggtgacttggaccactcacgcgttgccaaatccaatatgcagattttgaaacgc
ttgggagctgaactctttttcgctggacctgaggaatggagaagtcaagagtttgcagac
tatggaaagtttgtaaccattgatgaaatcattgatcaggttgatgtcatgatgtttctc
cgtgtgcaacacgaacgccatgatagtggagctgtattttcaaaagaagactaccatgcc
caacatggcttgactcaagaacgttacgatcgtttgaaagaaacagcaatcctcatgcac
ccagctccaatcaatcgtgatgtagaaatagcagaccacttggttgaagcaccaaaatca
cggattgtccaacaaatgaccaatggtgtctttgttcgaatggcaatcttagaatccgta
ctagcgagtagaaacgccaactaa

DBGET integrated database retrieval system