KEGG   Streptococcus pneumoniae G54 (serotype 19F): SPG_1565Help
Entry
SPG_1565          CDS       T00734                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
spx  Streptococcus pneumoniae G54 (serotype 19F)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:spx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPG_1565 (gpmA)
   01230 Biosynthesis of amino acids
    SPG_1565 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPG_1565 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    SPG_1565 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPG_1565 (gpmA)
Enzymes [BR:spx01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SPG_1565 (gpmA)
Exosome [BR:spx04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SPG_1565 (gpmA)
  Exosomal proteins of melanoma cells
   SPG_1565 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1507453..1508145)
Genome map
AA seq 230 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDQAYTSVLKR
AIKTTNLALEASDQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVL
PPNMDRDDEHSAHTDRRYASLDDSVIPDAENLKVTLERALPFWEDKIAPALKDGKNVFVG
AHGNSIRALVKHIKGLSDDEIMDVEIPNFPPLVFEFDEKLNVVSEYYLGK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattggtttttgctcgccacggtgagtctgaatggaacaaagctaaccttttc
actggttgggctgatgttgatttgtctgaaaaaggtacacaacaagcgattgatgctggt
aaattgatcaaagaagctggtatcgaatttgaccaagcttacacttcagtattgaaacgt
gctatcaaaacaactaacttggctcttgaagcttctgaccaattgtgggttccagttgaa
aaatcatggcgcttgaacgaacgtcactacggtggtttgactggtaaaaacaaagctgaa
gctgctgaacaatttggtgatgagcaagttcacatctggcgtcgttcatacgatgtattg
cctccaaacatggaccgtgatgatgagcactcagctcacacagaccgtcgttacgcttca
cttgacgactcagttatcccagatgctgaaaacttgaaagtgactttggaacgtgctctt
ccattctgggaagataaaatcgctccagctcttaaagatggtaaaaacgtattcgtagga
gctcacggtaactcaatccgtgcccttgtaaaacacatcaaaggtttgtcagatgatgag
atcatggacgtggaaatccctaacttcccaccattggtattcgaattcgacgaaaaattg
aacgttgtttctgaatactaccttggaaaataa

DBGET integrated database retrieval system