KEGG   Streptococcus pneumoniae G54 (serotype 19F): SPG_1707Help
Entry
SPG_1707          CDS       T00734                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
spx  Streptococcus pneumoniae G54 (serotype 19F)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:spx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SPG_1707 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPG_1707 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SPG_1707 (trpA)
Enzymes [BR:spx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SPG_1707 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1641229..1642005)
Genome map
AA seq 258 aa AA seqDB search
MPKTLTEKLNAIKATGKGIFVPYIMAGDHEKGLDGLAETIHFLEDLGVSAIEVGIPFSDP
VADGPVIEEAGLRSLAHGTSTQALVETLKTIETEIPLVIMTYFNPLFQYGVENFVKDLAD
TAVKGLIIPDLPHEHANFVEPFLADTDIALIPLVSLTTGIERQKELIEGAEGFVYAVAIN
GVTGKSGNYRADLDKHLAQLHQVADIPVLTGFGVSSQADLERFNAVSDGVIVGSKIVKAL
HQGEPIQDFIRQAVAYQK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcctaagacactaacagaaaaattgaatgctataaaagcaactggaaaaggaattttt
gttccctatatcatggctggtgaccacgagaaaggtttggacggtcttgctgaaacaatt
cactttttagaagatttgggtgtctctgctattgaagtgggtattcccttttcagaccct
gttgcagatggacctgttatcgaagaagctggcttgcgcagtttagcccacgggacctct
acccaggctttagttgaaaccttgaaaaccattgaaacagagattccactggtcatcatg
acctacttcaaccccctctttcagtacggtgtggagaactttgtcaaagatctggctgat
acagctgtgaagggcttgattatcccagacttgcctcatgaacatgccaactttgtagaa
ccatttttggcagatacagatatcgccttgattcctttagtaagcttgaccacaggaatt
gagcgccagaaagagttgattgaaggcgcggagggattcgtctatgccgttgccatcaat
ggggtgacagggaaatcaggcaattaccgtgcagatttggacaagcacttggcgcaactt
catcaagtggccgacatcccagtcttgacaggttttggtgtatctagtcaagccgatctg
gaacgcttcaatgcggtgtcagatggtgttatcgtcggttcgaaaatagtaaaagctctc
caccaaggagagccgattcaggattttatcagacaagcagtagcttaccaaaaataa

DBGET integrated database retrieval system