KEGG   Streptococcus pneumoniae G54 (serotype 19F): SPG_1785Help
Entry
SPG_1785          CDS       T00734                                 

Definition
alpha-galactosidase AgaN
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
spx  Streptococcus pneumoniae G54 (serotype 19F)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:spx00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:spx00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:spx00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1721139..1723301)
Genome map
AA seq 720 aa AA seqDB search
MGVRIENNLFYVESKNLSLIIENRNGYLLLKHLGKTIKNYKGSNSVYERDHAFSGNPTAT
NRTFSLDTQRQIFGQHGLGDFRKPTIQVQHSVTEVTDFRFVEAKILKGQNGPQGLPSPHS
MDDTETLVLMLEDSKAQLSLTLYYTTFNNDATIASYSKLDNNSNQEVVIHKDFSFMADFP
AADYEIVTLQGAYAREKTVRRQQVEQGIFSISSNRGASGHAQTPALLLCEQGVTEDAGNV
FAIQLMYSGNFEAFVQKNQLNEVRVAIGINPENFSWKLAPEEYFETPVALVTHSDQGLTG
ISHESQNFVLKHIILSEFSKKERPILINNWEATYFDFQREKLLELADEAKKVGIELFVLD
DGWFGNRFDDNRALGDWVVNEEKLGGSLESLISAIHERGLQFGLWLEPEMISVDSDLYRQ
HPDWAIQVPDYEHTYSRNQLVLNLANPQVVEYLKSVLDQLLSYHEIDYIKWDMNRNITKL
GNGLTYLETQMQSHQYMLGLYELVSYLTEKHSHILFESCSGGGGRNDLGMIRYFPQVWAS
DNTDAIARLPIQYGSSYLYPTISMGAHVSAVPNHQMGRMTPLETRGHVAMMGNLGYELDL
TNLSDEEKATIANQVNLYKELRPVVQLGQQYRLINPDTASNEAAVQFNYGNQTIVTYVRV
LSVVETMETTLKLKDLDEEGLYKLQENGEVYSGAELMYAGLTVILSQGDFLSRQYIFRKL
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgggagttaggatagagaataatctattttatgttgagagtaaaaatctaagtttgatt
attgaaaatcgaaatggctacttacttttgaaacatttaggaaagactattaagaactat
aaaggttccaatagtgtttatgaacgagaccatgccttttcaggaaatccaacggctact
aatcgaacctttagtttagatactcagcgacagatttttggacaacatggcttaggagat
tttaggaaaccaaccatacaggttcagcatagtgtaactgaagtaacagactttcgattt
gtagaagcaaagattttaaaaggtcagaatggtccacagggcttaccttctccacatagc
atggacgatacagagactcttgtcttaatgttagaagattctaaggctcaacttagtctg
actttgtattatactacttttaataatgatgcgactattgctagctacagtaaattagat
aataatagtaatcaggaagttgtcatccataaagatttttcttttatggctgattttcca
gctgcagattacgaaatagtaactctgcagggtgcttatgctcgtgaaaagactgttaga
cgtcaacaggtagaacaaggaatcttttcgattagctcaaaccgaggtgcttctggtcat
gctcaaacaccagctcttctactatgcgaacaaggagtcacagaggatgctgggaatgtg
tttgctattcaactaatgtatagtggcaactttgaagcttttgttcaaaaaaatcaattg
aatgaagttcgggtggctattggcattaatccagaaaacttttcttggaagttagcccct
gaggaatactttgaaacaccggtagctttagtgactcattcagatcagggattaactggt
attagtcatgaaagtcagaattttgtactgaagcacattattctaagtgaattttctaaa
aaagaacgtccaattctaatcaataactgggaagctacttactttgactttcagagagaa
aaactgttagagttagcagatgaagctaagaaagttggcattgaactttttgtattagat
gatggttggtttggcaatcgttttgatgataatcgtgctttaggtgattgggttgttaat
gaggaaaaactgggtggaagtctagaaagtctgatttcagctatccatgaaagaggtttg
cagtttggactttggttagaacccgaaatgatttctgtagatagtgatttgtatcgtcaa
catcctgactgggctattcaggttcctgattatgagcatacttattctcggaatcaatta
gtacttaatcttgccaatcctcaggtagtagaatacttgaaaagtgtcttagatcaactc
ctatcttatcatgagattgattacattaaatgggatatgaaccgcaatatcactaagcta
gggaatggattaacttatctagagacacagatgcaatctcatcagtacatgctggggctt
tacgaactcgtttcttatctgacagagaagcacagccatattctctttgagtcctgctct
ggtggtggtggacgaaatgatcttggtatgatacgctatttcccacaagtctgggctagt
gataatactgatgccattgcacgtttaccaattcaatacggttcatcctatctctatcca
accatttctatgggggctcatgtgtcagcagtaccgaatcatcagatgggacgaatgaca
ccattagaaacacgtggccatgtagcaatgatgggaaatttgggctatgagcttgatttg
acaaatttatcagatgaagagaaagctacgattgctaatcaggtgaacttgtataaagaa
ttacgaccagtagttcagttaggacagcagtatagactaattaatcctgatactgcatcc
aatgaagcagctgtacaatttaattacggaaatcaaacgattgtaacctacgttcgcgtt
ttatctgttgtagagaccatggaaacaactttaaaattaaaagatttggatgaagaggga
ctatataaattacaggaaaatggcgaagtttactcaggtgcagaactaatgtatgcgggc
ttaactgttatcttatcccaaggagattttttgagtagacagtatatttttagaaaacta
tga

DBGET integrated database retrieval system