KEGG   Streptococcus pneumoniae G54 (serotype 19F): SPG_1938Help
Entry
SPG_1938          CDS       T00734                                 

Definition
(RefSeq) bifunctional acetaldehyde-CoA/alcohol dehydrogenase (EC:1.1.1.1)
  KO
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
spx  Streptococcus pneumoniae G54 (serotype 19F)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:spx00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SPG_1938
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPG_1938
   00620 Pyruvate metabolism
    SPG_1938
   00650 Butanoate metabolism
    SPG_1938
  Lipid metabolism
   00071 Fatty acid degradation
    SPG_1938
  Amino acid metabolism
   00350 Tyrosine metabolism
    SPG_1938
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SPG_1938
   00626 Naphthalene degradation
    SPG_1938
Enzymes [BR:spx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SPG_1938
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SPG_1938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1840722..1843373)
Genome map
AA seq 883 aa AA seqDB search
MADKKTVTPEEKKLVAEKHVDELVQKALVALEEMRKLDQEQVDYIVAKASVAALDAHGEL
ALHAFEETGRGVFEDKATKNLFACEHVVNNMRHTKTVGVIEEDDVTGLTLIAEPVGVVCG
ITPTTNPTSTAIFKSLISLKTRNPIVFAFHPSAQESSAHAARIVRDAAIAAGAPENCVQW
ITQPSMEATSALMNHEGVATILATGGNAMVKAAYSCGKPALGVGAGNVPAYVEKSANIRQ
AAHDIVMSKSFDNGMVCASEQAVIIDKEIYDEFVAEFKSYHTYFVNKKEKALLEEFCFGV
KANSKNCAGAKLNADIVGKPATWIAEQAGFTVPEGTNILAAECKEVGENEPLTREKLSPV
IAVLKSESREDGITKARQMVEFNGLGHSAAIHTADEELTKEFGKAVKAIRVICNSPSTFG
GIGDVYNAFLPSLTLGCGSYGRNSVGDNVSAINLLNIKKVGRRRNNMQWMKLPSKTYFER
DSIQYLQKCRDVERVMIVTDHAMVELGFLDRIIEQLDLRRNKVVYQIFADVEPDPDITTV
NRGTEIMRAFKPDTIIALGGGSPMDAAKVMWLFYEQPEVDFRDLVQKFMDIRKRAFKFPL
LGKKTKFIAIPTTSGTGSEVTPFAVISDKANNRKYPIADYSLTPTVAIVDPALVLTVPGF
VAADTGMDVLTHATEAYVSQMASDYTDGLALQAIKLVFENLESSVKNADFHSREKMHNAS
TIAGMAFANAFLGISHSMAHKIGAQFHTVHGRTNAILLPYVIRYNGTRPAKTATWPKYNY
YRADEKYQDIARMLGLPASTPEEGVESYAKAVYELGERIGIQMNFRDQGIDEKEWKEHSR
KLAFLAYEDQCSPANPRLPMVDHMQEIIEDAYYGYKERPGRRK
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atggctgataaaaaaactgtgacaccagaggaaaagaaactcgttgctgaaaaacacgta
gatgagttggttcaaaaagctctagttgcccttgaagaaatgcgtaaattggatcaagag
caagttgactacatcgttgccaaagcatcagtagcagctttggatgcccacggagaattg
gctttacatgcctttgaagaaacaggacgtggtgtatttgaagataaagcaactaagaac
ttgtttgcctgtgaacacgtagtaaacaacatgcgtcacactaagacagttggcgttatc
gaagaagacgatgtaacaggattgactcttattgctgaaccagttggtgttgtttgtggt
attactccaacaacaaacccaacatcaacagcaatcttcaaatcattgatttcattgaag
acacgtaacccaatcgtctttgccttccatccatcagcacaagaatcatctgctcatgca
gctcgtatcgtccgcgatgcagctatcgcagctggtgctcctgaaaactgtgtgcaatgg
attactcaaccatctatggaagcaacaagtgcccttatgaaccacgaaggtgttgcgaca
atccttgcaacaggtggtaatgccatggttaaggcggcttattcatgtggtaaaccagct
cttggggtaggtgccggaaacgttccagcttatgttgaaaaatcagcaaacattcgtcaa
gcagcacacgatatcgtcatgtctaaatcatttgataacggtatggtctgtgcatctgaa
caagcagttatcattgataaagaaatttacgatgaatttgtagcagagttcaaatcttac
cacacttactttgtaaacaaaaaagaaaaagctcttcttgaagagttctgcttcggcgtc
aaagcaaacagcaaaaactgtgctggtgcaaaattgaacgctgacatcgttggtaaacca
gcaacttggattgcagaacaagcaggatttacagttccagaaggaacaaacattcttgct
gcagaatgtaaagaagttggcgaaaatgagccattgactcgtgaaaaattgtcaccagtt
attgcagttttgaaatctgaaagccgtgaagatggtattactaaggctcgtcaaatggtt
gaatttaacggtcttggacactcagcagctatccacacagctgacgaagaattgactaaa
gaatttggtaaagctgttaaagctattcgtgttatctgtaactcaccttctacttttggt
ggtatcggggacgtttacaatgccttcttgccatcattgacacttggatgtggttcttac
ggacgaaactcagttggggataacgttagtgccattaacctcttgaatatcaaaaaagtc
ggaagacggagaaataacatgcaatggatgaaacttccttcaaaaacatactttgaacgt
gattcaattcaataccttcaaaaatgtcgtgacgttgaacgtgtcatgatcgttactgac
catgccatggtagagcttggtttccttgatcgtatcatcgaacaactggaccttcgtcgc
aataaggttgtttaccaaatctttgcggatgtagaaccggatccagatatcacaactgta
aaccgtggtactgagattatgcgtgccttcaaaccagataccatcatcgcactcggtggt
gggtctccaatggatgctgccaaagtaatgtggcttttctacgagcaaccagaagtggac
ttccgtgaccttgtccaaaaattcatggatatccgtaaacgtgccttcaagttcccattg
cttggtaagaagactaaattcatcgcgattccaactacatctggtacaggatctgaagta
acaccatttgccgttatctctgataaagcaaacaaccgtaaatacccaatcgctgactac
tcattgacaccaactgtggcaattgtagaccctgctttggtattgacagttccaggattt
gttgctgctgatactggtatggacgtattgactcacgcgacagaagcatacgtatcacaa
atggctagtgactacactgatggtttagcacttcaagctattaaattggtctttgaaaat
ctcgaaagctcagttaagaatgcagacttccactcacgtgagaaaatgcataacgcttca
acaatcgctggtatggcctttgccaatgccttcctaggtatttctcactcaatggcccat
aagattggtgcgcaattccacacagttcacggacgtacaaatgccatcttgcttccgtac
gttatccgttacaacggtacacgtccagctaagacagcaacatggcctaagtacaactac
taccgtgcagatgaaaaataccaagatatcgcacgcatgcttggacttccagcttctact
ccagaagaaggggttgaatcttacgcaaaagctgtctacgaactcggtgaacgtattggg
atccaaatgaattttagagaccaaggaattgacgaaaaagaatggaaagaacattctcgt
aaattagccttcctggcttatgaagaccaatgttcaccagctaacccacgtcttccaatg
gtagaccatatgcaagaaatcatcgaagatgcatactatggctacaaagaaagaccagga
cgccgtaaataa

DBGET integrated database retrieval system