KEGG   Streptococcus pneumoniae G54 (serotype 19F): SPG_1970Help
Entry
SPG_1970          CDS       T00734                                 

Definition
alcohol dehydrogenase
Orthology
K18369  
alcohol dehydrogenase [EC:1.1.1.-]
Organism
spx  Streptococcus pneumoniae G54 (serotype 19F)
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:spx00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SPG_1970
Enzymes [BR:spx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     SPG_1970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1865111..1866169)
Genome map
AA seq 352 aa AA seqDB search
MKAYTYVKPGLASFVDVDKPVIRKPTDAIVRIVKTTICGTDLHIIKGDVPTCQSGTILGH
EGIGIVEEVGEGVSNFKKGDKVLISCVCACGKCYYCKKGIYAHCEDEGGWIFGHLIDGMQ
AEYLRVPHADNTLYHTPEDLSDEALVMLSDILPTGYEIGVLKGKVEPGCSVAIIGSGPVG
LAALLTAQFYSPAKLIMVDLDDNRLETALSFGATHKVNSSDPEKAIKEIYDLTDGRGVDV
AIEAVGIPATFDFCQKIIGVDGTVANCGVHGKPVEFDLDKLWIRNINVTTGLVSTNTTPQ
LLKALESHKIEPEKLVTHYFKLSEIEKAYEVFSKAADHHAIKVIIENDISEA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcctatacttatgttaaaccaggacttgcttcttttgttgatgtagacaaacca
gttattcgcaagccaacagacgctattgtgcgtattgtaaaaaccactatttgtggaaca
gacctccatattatcaaaggggatgttcctacttgccaaagtggtaccattcttggccac
gaagggattgggattgttgaagaagttggggaaggagtttccaacttcaaaaaaggtgac
aaggtcttgatttcttgcgtctgtgcctgtggtaaatgctactactgtaaaaaaggaatt
tatgctcactgtgaagacgaagggggctggattttcggtcacttgattgatggtatgcag
gctgaatatctacgtgtccctcatgcagataatactctttaccatactccagaagacttg
tcagatgaagctttggttatgctgtcagacattctgcctactggatatgaaattggtgtc
ttaaaagggaaagtagaacctggttgcagcgtagccattattggttcaggtccagttgga
ttggctgctcttttaacagcccaattctattcaccagctaaattgattatggtagaccta
gacgataaccgcttggaaactgccctatcattcggtgcgactcataaggttaattcttca
gaccctgaaaaagccattaaagaaatttatgatttgacagatggtcgtggtgtggatgtc
gctatcgaagctgttggtattcctgcaacatttgatttctgtcaaaagattatcggtgta
gacggaacggttgccaactgtggtgtgcatggtaaaccagttgaattcgatttagataaa
ctttggattcgcaacatcaatgtaacaactggtttggtatctacaaatacgactccacaa
ttgttgaaagcgcttgaaagtcataagattgaaccagaaaaattggtaactcactatttc
aaactcagtgaaattgaaaaagcctacgaagtcttcagtaaggcagcagaccaccatgcc
attaaggtcattatcgaaaacgatatctcagaagcctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system