KEGG   Streptococcus pneumoniae G54 (serotype 19F): SPG_2098Help
Entry
SPG_2098          CDS       T00734                                 

Definition
L-fucose isomerase (EC:5.3.1.25)
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
spx  Streptococcus pneumoniae G54 (serotype 19F)
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:spx00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SPG_2098
Enzymes [BR:spx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.25  L-fucose isomerase
     SPG_2098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1986365..1987879)
Genome map
AA seq 504 aa AA seqDB search
MIQHPRIGIRPTIDGRRQGVRESLEVQTMNMAKSVADLISSTLKYPDGEPVECVISPSTI
GRVPEAAASHELFKKSNVCATITVTPCWCYGSETMDMSPDIPHAIWGFNGTERPGAVYLA
AVLASHAQKGIPAFGIYGRDVQEANDTDIPEDVKEKLLRYARAALATGLMRDTAYLSMGS
VSMGIGGSIVNPDFFQEYLGMRNESVDMTEFTRRMDRGIYDPEEFERALKWVKENVKEGF
DHNREDLVLSREEKDRQWEFVIKMFMIGRDLMVGNPRLAELGFEEEAVGHHALVAGFQGQ
RQWTDHFPNGDFMETFLNTQFDWNGIRKPFVFATENDSLNGVSMLFNYLLTNTPQIFADV
RTYWSPEAVKRVTGHTLEGRAAAGFLHLINSGSCTLDGTGQATRDGKPIMKPFWELEESE
VQAMLENTDFPPANREYFRGGGFSTRFLTKGDMPVTMVRLNLLKGVGPVLQIAEGYTLEL
PEDVHHTLDNRTDPGWPILGLLHV
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgattcaacatccacgtattggtattcgtccgactattgatggtcgtcgtcaaggtgta
cgcgaatcacttgaagtgcaaacaatgaacatggctaaaagtgtggcagatttgatttca
agcacattgaaatatccagatggggaacctgtggaatgtgtgatttctccatctaccatt
ggtcgtgttccagaggctgcagcttcccatgagttgtttaaaaaatcaaatgtttgcgca
acaattacagttacaccatgctggtgttatggtagtgaaactatggatatgtctccagat
attcctcatgctatttggggatttaatgggacagaacgcccaggagctgtctatcttgca
gctgtactagcttcacatgctcaaaaagggattccagcctttgggatttatggtagagat
gttcaggaagctaatgatacagatattccagaagatgtcaaagaaaaacttttacgttat
gcgcgtgcagctcttgcaactggcttgatgagagacactgcttacctatcaatgggtagt
gtttcgatggggattggtggttctattgtaaatccagatttcttccaagaatacttagga
atgcgaaatgaatcggtagatatgacggagttcacacgccgtatggaccgtggtatttac
gaccctgaagagttcgaacgtgcgctcaaatgggtgaaagaaaacgtaaaagaaggattc
gaccataaccgtgaagaccttgttttaagccgtgaagaaaaagatagacaatgggaattt
gttattaagatgttcatgattggacgtgacttaatggttggtaacccaagacttgctgaa
cttggttttgaggaagaagcagttggtcaccatgctttagtagctggtttccaaggtcaa
cgccagtggacagaccattttccaaatggtgactttatggaaactttcctcaatactcag
tttgactggaatggtattcgaaaaccatttgtatttgcgacagagaatgattcactaaat
ggtgtgtctatgctctttaattatctattaacaaatactccacaaatctttgctgatgtg
cgtacttattggagcccagaggctgttaaacgtgtaacgggacatactttagagggtcgt
gctgcagctggcttcttacatctaatcaactctggttcttgtacattggatggtacaggt
caagctactcgagatggcaaacctattatgaaaccattctgggagttggaagaaagtgaa
gtgcaggctatgcttgaaaatacagacttcccaccagcaaaccgcgaatacttccgtgga
ggaggattctcaactcgtttcttgacgaagggggatatgccagtaacaatggtacgtctc
aatcttctaaaaggggttggtccagtgctacaaattgcagaaggttacacacttgaactt
cctgaagatgttcaccatactttagataatcgtacagatccaggatggccaatacttggt
ttgctccacgtttga

DBGET integrated database retrieval system