KEGG   Streptococcus pneumoniae G54 (serotype 19F): SPG_2099Help
Entry
SPG_2099          CDS       T00734                                 

Definition
L-fuculose-phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
spx  Streptococcus pneumoniae G54 (serotype 19F)
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:spx00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SPG_2099
Enzymes [BR:spx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     SPG_2099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1987892..1988620)
Genome map
AA seq 242 aa AA seqDB search
MSQDEKLIREQICDVCHKMWQLGWVAANDGNVSVRLDEDTILATPTGISKSFITPEKLVK
LNLKGEILEAEGDYRPSSEIKMHIRCYEEREDVRSVVHAHPPIATGFALAHIPLDTYSLI
ESAIVVGAIPITPFGVPSTMEVPEAITPYLPDHDVMLLENHGALTVGSDVITAYYRMETL
ELVAKTTFHGRMLLSTKGIEEQEIARPTLERLFSMRENYKVTGRHPGYRKYNGDGSMKET
EK
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaagatgaaaaattaattcgtgaacagatttgtgatgtttgtcataagatgtgg
caacttggttgggttgctgctaacgatgggaatgtatctgttcgattagatgaggatacc
attcttgcaacacctactggtatcagcaaaagttttattactccagaaaagctggtgaag
ttaaatctcaaaggagagattttagaagcagaaggtgattaccggccctctagtgaaatt
aaaatgcacattcgttgttacgaagaacgtgaggatgtccgttcagttgttcacgcgcat
ccaccgattgcaacaggatttgctcttgcacacattcctttagatacttattcactaatt
gagagcgcgattgtggtaggggcaattcctataacgccatttggagttccgtctacaatg
gaagtgccagaagcaattacaccttatctgcccgatcatgatgtcatgctattagaaaat
catggagctctgactgtcggaagcgatgtcattacagcatactaccgtatggaaacttta
gaattagtcgcaaagacaacattccacggaagaatgttactttctacaaagggcattgag
gagcaagaaattgctcgtccgactttagaacgtctattctcaatgcgagaaaattataag
gttacaggtcgtcacccaggctaccgtaaatataatggagatggtagtatgaaagaaaca
gaaaaataa

DBGET integrated database retrieval system