KEGG   Streptococcus pneumoniae G54 (serotype 19F): SPG_2126Help
Entry
SPG_2126          CDS       T00734                                 

Definition
(GenBank) alpha-glycerophosphate oxidase
  KO
K00105  alpha-glycerophosphate oxidase [EC:1.1.3.21]
Organism
spx  Streptococcus pneumoniae G54 (serotype 19F)
Pathway
spx00564  Glycerophospholipid metabolism
spx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spx00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SPG_2126
Enzymes [BR:spx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.21  glycerol-3-phosphate oxidase
     SPG_2126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored Pyr_redox_2 GIDA NAD_binding_8 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ACF56548
Position
complement(2017812..2019638)
Genome map
AA seq 608 aa AA seqDB search
MEFSKKTRELSIKKMQERTLDLLIIGGGITGAGVALQAAASGLETGLIEMQDFAEGTSSR
STKLVHGGLRYLKQFDVEVVSDTVSERAVVQQIAPHIPKPDPMLLPVYDEDGATFSLFRL
KVAMDLYDLLAGVSNTSAANKVLSKDQVLERQPNLKKEGLVGGGVYLDFRNNDARLVIEN
IKRANQDGALIANHVKAEGFLFDESGKITGVVARDLLTDQVFEIKARLVINTTGPWSDKV
RNLSNKGTQFSQMRPTKGVHLVVDSSKIKVSQPVYFDTGLGDGRMVFVLPRENKTYFGTT
DTDYTGDLEHPKVTQEDVDYLLGIVNNRFPESNITIDDIESSWAGLRPLIAGNSASDYNG
GNNGTISDESFDNLIATVESYLSKEKTREDVESAVSKLESSTSEKHLDPSAVSRGSSLDR
DDNGLLTLAGGKITDYRKMAEGAMERVVDILKAEFDRSFKLINSKTYPVSGGELNPANVD
SEIEAFAQLGVSRGLDSKEAHYLANFYGSNAPKVFALAHSLEQAPGLSLADTLSLHYAMR
NELTLSPVDFLLRRTNHMLFMRDSLDSIVEPVLDEMGRFYDWTEEEKATYRADVKATLAN
NDLAELKN
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atggaattttcaaagaaaacacgtgaattgtcaattaaaaaaatgcaggaacgcaccctg
gacctcttgattatcggtggaggaatcacaggagctggtgtagccttgcaggcggcagct
agcggtcttgagactggtttgattgaaatgcaagactttgcagaaggaacatctagtcgt
tcaacaaaattggttcacggaggacttcgttacctcaaacaatttgacgtagaagtggtc
tcagatacggtttctgaacgtgcagtggttcaacaaatcgctccacacattccaaaacca
gatccaatgctcttaccagtttacgatgaagatggagcaacctttagcctcttccgtctt
aaagtagccatggacttgtacgaccttttagcaggtgtgagcaacacgtcagctgcgaac
aaggttttgagcaaggatcaagtcttggaacgccagccaaacttgaagaaggaaggcttg
gtaggaggtggagtgtatcttgacttccgtaacaacgatgcgcgtctcgtgattgaaaac
atcaaacgtgccaaccaagacggtgccctcattgccaaccacgtgaaggcagaaggcttc
ctctttgacgaaagtggcaagattacaggtgttgtagctcgtgatctcttgacagaccaa
gtatttgaaatcaaggcccgtctggttattaatacaacaggtccttggagtgataaagta
cgtaatttgtctaataagggaacgcaattctcacaaatgcgcccaactaagggagttcac
ttggtagtggattcaagcaaaatcaaggtttcacagccagtttactttgacacaggtttg
ggtgacggtcgtatggtctttgttctcccacgtgaaaacaagacttactttggtacaact
gatacagactacacaggtgatttggagcatccaaaagtaactcaagaagatgtagattat
ctacttggcattgtcaacaaccgctttccagaatccaacatcaccattgatgatatcgaa
agcagctgggcaggtcttcgtccattgattgcagggaacagtgcctctgactataatggt
ggaaataacggtaccatcagtgatgaaagctttgacaacttgattgcgactgttgaatct
tatctctccaaagaaaaaacacgtgaagatgttgagtctgctgtcagcaagcttgaaagt
agcacatctgagaaacatttggatccatctgcagtttctcgtgggtctagcttggaccgt
gatgacaatggtcttttgactcttgctggcggtaaaatcacagactaccgtaagatggct
gaaggagctatggagcgcgtggttgacatcctcaaagcagaatttgaccgtagctttaaa
ttgatcaattctaaaacttaccctgtttcaggtggagaattgaacccagcaaatgtggat
tcagaaatcgaagcctttgcgcaacttggagtttcacgtggtttggatagcaaggaagct
cattacctagcaaatttttacggttcaaatgcaccgaaggtctttgcacttgctcacagc
ttggaacaagcgccaggtcttagcttggcagacaccttgtcccttcactatgcaatgcgc
aatgagttgactcttagcccagttgacttccttcttcgtcgtaccaatcacatgctcttt
atgcgtgatagcttggatagtatcgttgagccagttttggatgaaatgggacgattctat
gactggacagaagaagaaaaagcaacttaccgtgctgatgtaaaagcaactcttgctaat
aatgatttagcagaattaaaaaattaa

DBGET integrated database retrieval system