KEGG   Streptococcus pneumoniae G54 (serotype 19F): SPG_2166Help
Entry
SPG_2166          CDS       T00734                                 

Gene name
cbiO
Definition
cobalt transporter ATP-binding subunit
Orthology
K16787  
energy-coupling factor transport system ATP-binding protein [EC:3.6.3.-]
Organism
spx  Streptococcus pneumoniae G54 (serotype 19F)
Pathway
ABC transporters
Module
Energy-coupling factor transport system
Brite
KEGG Orthology (KO) [BR:spx00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SPG_2166 (cbiO)
Enzymes [BR:spx01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     SPG_2166 (cbiO)
Transporters [BR:spx02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Energy-coupling factor transporter [MD:M00582] [OT]
    Shared module
     SPG_2166 (cbiO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2056807..2057646)
Genome map
AA seq 279 aa AA seqDB search
MGIALENVNFTYQEGTPLASAALSDVSLTIEDGSYTALIGHTGSGKSTILQLLNGLLVPS
QGSVRVFDTLITSTSKNKDIRQIRKQVGLVFQFAENQIFEETVLKDVAFGPQNFGVSEED
AVKTAREKLALVGIDESLFDRSPFELSGGQMRRVAIAGILAMEPAILVLDEPTAGLDPLG
RKELMTLFKKLHQSGMTIVLVTHLMDDVAEYANQVYVMEKGRLVKGGKPSDVFQDVVFME
EVQLGVPKITAFCKRLADRGVSFKRLPIKIEEFKESLNG
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgggaattgctctagaaaatgtgaattttacatatcaagaaggtactcccttagcttca
gcagctttgtcggatgtttctttgacgattgaagatggctcttatacagctttaattggg
cacacaggtagtggtaaatcaactattttacaactcttaaatggtttattggtgccaagt
caagggagtgtgagggtttttgataccttaatcacctcgacttctaaaaataaagatatt
cgtcaaattagaaaacaggttggcttggtatttcagtttgctgaaaatcagatttttgaa
gaaacggttttgaaggacgttgcttttggaccgcaaaattttggagtttctgaagaagat
gctgtgaagactgcgcgtgagaaactggctctggttggaattgatgaatcactttttgat
cgtagtccgtttgagctgtcagggggacaaatgagacgtgttgccattgcaggcatactt
gccatggagccagctatattagtcttagatgagccaacagctggtctagatcctctaggg
agaaaagagttgatgaccctgttcaaaaaactccaccagtcagggatgaccatcgtcttg
gtaacgcatttgatggatgatgttgctgaatatgcaaatcaagtctatgtaatggaaaag
ggacgtttagtaaaggggggcaaaccaagtgatgtctttcaagacgttgtttttatggaa
gaagttcagttgggagtacctaaaattacggccttttgtaaacgattggctgatagaggc
gtgtcatttaaacgattaccgattaagatagaggagttcaaggagtcgctaaatggatag

DBGET integrated database retrieval system