KEGG   Streptococcus pyogenes M1 GAS (serotype M1): SPy_0224Help
Entry
SPy_0224          CDS       T00050                                 

Gene name
hasC.2
Definition
(RefSeq) putative UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
spy  Streptococcus pyogenes M1 GAS (serotype M1)
Pathway
spy00040  Pentose and glucuronate interconversions
spy00052  Galactose metabolism
spy00500  Starch and sucrose metabolism
spy00520  Amino sugar and nucleotide sugar metabolism
spy01100  Metabolic pathways
spy01130  Biosynthesis of antibiotics
Module
spy_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:spy00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SPy_0224 (hasC.2)
   00052 Galactose metabolism
    SPy_0224 (hasC.2)
   00500 Starch and sucrose metabolism
    SPy_0224 (hasC.2)
   00520 Amino sugar and nucleotide sugar metabolism
    SPy_0224 (hasC.2)
Enzymes [BR:spy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SPy_0224 (hasC.2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-GeneID: 900533
NCBI-ProteinID: NP_268587
UniProt: P67068
Position
complement(197663..198562)
Genome map
AA seq 299 aa AA seqDB search
MTKVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILIVTGKS
KRSIEDHFDSNFELEYNLQAKGKIELLKLVDETTSINLHFIRQSHPRGLGDAVLQAKTFV
GNEPFVVMLGDDLMDITNPNVKPLTKQLIDDYEETHAATIAVMRVPHEDVSNYGIIAPQA
KAVKGLYSVDTFVEKPQPQDAPSDLAIIGRYLLTPEIFSILEKQEPGAGNEVQLTDAIDT
LNKTQRVFAREFKGKRYDVGDKFGFMKTSLDYALKHPQVKDDLKAYIIQLGKALEKTKP
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagtcagaaaagctattattcccgcagcaggtttaggcacacgttttttacct
gcaaccaaggcccttgccaaggagatgctacctattgttgataaaccaactattcaattt
atcgttgaagaagctctaaaatcaggtatcgaagaaattcttatcgttactggaaaatcc
aaacgctccatagaagatcattttgattctaattttgaattagaatataatttacaggct
aaaggaaaaatcgaacttctaaagttagtagacgagaccacttctattaatcttcacttt
attcgacagagtcatccaagaggattaggagacgcagttcttcaagcaaagacctttgtt
ggcaatgaaccttttgttgtcatgctaggtgatgatctgatggatattacaaatccaaat
gtaaaaccattaaccaaacaattgatcgatgactatgaagaaactcatgctgcaactatt
gccgtcatgagggttcctcacgaggatgtctctaactacggtatcattgctcctcaagca
aaagcagtaaaaggactctatagtgtggatacttttgttgaaaaaccacaacctcaagat
gcacctagtgatttggcaattattggacgttacttgctcacaccagaaatttttagtatt
ttagaaaaacaagaacctggtgcaggcaatgaagttcaactgactgatgctattgatacc
ctcaataagacacagcgtgtctttgctcgtgagtttaaagggaaacgctatgatgttggc
gataaatttgggtttatgaaaacttctttggattatgccctgaaacaccctcaagtcaaa
gatgacttgaaagcctacatcatccaactgggcaaagcactagagaagacaaaaccataa

DBGET integrated database retrieval system