KEGG   Streptococcus pyogenes SF370 (serotype M1): SPy_0239Help
Entry
SPy_0239          CDS       T00050                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
spy  Streptococcus pyogenes SF370 (serotype M1)
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:spy00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    SPy_0239 (gltX)
Enzymes [BR:spy01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     SPy_0239 (gltX)
Amino acid related enzymes [BR:spy01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   SPy_0239 (gltX)
Transfer RNA biogenesis [BR:spy03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    SPy_0239 (gltX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
208437..209882
Genome map
AA seq 481 aa AA seqDB search
MSKPIRVRYAPSPTGLLHIGNARTALFNYLYARRHGGTFIIRIEDTDRKRHVEDGERSQL
ENLKWLGMDWDESPETHENYRQSERLALYQQYIDQLLAEGKAYKSYVTEEELAAERERQE
AAGETPRYINEFIGMSADEKAKYIAEREAAGIVPTVRLAVNESGIYKWTDMVKGDIEFEG
GNIGGDWVIQKKDGYPTYNFAVVVDDHDMQISHVIRGDDHIANTPKQLMVYEALGWEAPE
FGHMTLIINSETGKKLSKRDTNTLQFIEDYRKKGYMPEAVFNFIALLGWNPGGEEEIFSR
EQLIALFDENRLSKSPAAFDQKKMDWMSNEYLKHADFETVYALCKPFLEEAGRLTEKAEK
LVELYKPQLKSADEIIPLTDLFFSDFPELTEAEKEVMAGETVSTVLQAFKAKLEAMSDED
FKPENIFPQIKAVQKETGIKGKNLFMPIRIAVSGEMHGPELPNTIYLLGRDKSIEHIKNM
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaccaattcgtgtgcgttatgcaccaagtccaacagggcttttacatatcggg
aatgcccgcacagccctatttaattacctttatgcccgtcgtcacggaggtacttttatc
attcgtattgaagatactgaccgtaaacgtcatgttgaagatggtgaacgttctcaactt
gaaaacctaaaatggttaggaatggattgggatgaaagcccagaaacgcatgaaaattac
cgccagtctgaacgtctagcactttatcaacaatatattgatcaattgttagctgaagga
aaagcctacaagtcttacgtgactgaggaagaattggcagcagagcgtgaacgccaagaa
gcagctggcgaaacgcctcgctatatcaatgaatttattggtatgtcagctgacgaaaaa
gctaagtacattgctgagcgtgaagcagcaggtatcgttccaacagtccgtcttgctgtt
aatgagtccggtatttacaaatggactgacatggttaaaggcgatatcgagtttgaaggt
ggtaacatcggtggtgactgggttattcaaaagaaagatggctatccaacttataacttt
gccgttgttgttgatgatcatgatatgcaaatttctcacgttatccgtggcgatgaccat
attgccaatacgccaaaacaattgatggtctatgaagctcttggctgggaagcgccagag
tttggtcatatgactcttatcatcaattctgaaacgggtaaaaaattatcaaaacgcgac
accaataccctccaattcattgaagattaccgcaaaaaaggttatatgcctgaagctgtc
tttaacttcatcgcccttcttggctggaatcctggcggagaagaggaaatcttctctcgt
gagcaactgattgccctttttgatgaaaatcgccttagcaagtcgccagctgcctttgac
cagaagaaaatggattggatgagcaatgagtatcttaaacatgcggattttgaaacagtt
tatgccctctgcaaaccattccttgaagaggcaggccgtttgacagaaaaagctgagaag
ctagtagaattatacaaacctcaattaaaatctgcagatgagattattccattgactgac
cttttcttttctgatttccctgaattaacagaagccgaaaaagaagtgatggcaggtgaa
acagtttcgacagtcttgcaagctttcaaggctaagttggaagctatgtcagatgaagac
ttcaaaccagaaaatattttcccacaaattaaggctgttcaaaaagaaacaggaatcaaa
gggaaaaacctctttatgcctattcgtattgcagtatctggtgaaatgcatggcccagaa
ttaccaaatacgatttatttattgggacgtgataaatccattgagcacatcaaaaacatg
ctataa

DBGET integrated database retrieval system