KEGG   Streptococcus pyogenes SF370 (serotype M1): SPy_0574Help
Entry
SPy_0574          CDS       T00050                                 

Gene name
bglA
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
spy  Streptococcus pyogenes SF370 (serotype M1)
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:spy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPy_0574 (bglA)
Enzymes [BR:spy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SPy_0574 (bglA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
464708..466132
Genome map
AA seq 474 aa AA seqDB search
MGIFPKDFLWGGAVAANQVEGAFEADAKGLSVQDVLPNGGLGEWTDSPTSDNLTLEAIDF
YHRYKEDIALFAEMGFKVFRTSIAWSRIFPNGDDDQPNEAGLQFYDDLFDELLNYGIEPL
VTLSHYETPLHLAKAYNGWTDRRLIGFFERFAQTVMERYKDKVKYWLTFNEVNSILHMPF
TSGGIMTEKEKLSLQDLYQAIHHELVASASVTKLAHEINPDVKVGCMILAMPAYPMTSDP
RDILAAHAFENLNLLFSDIHVRGKYPSYIKSYFKENGIEIVFEDGDKELLAEHTVDFLSF
SYYMSVTQAHNPEAYTSGQGNILGGLSNPYLESSEWGWQIDPIGLRLVLNQYYDRYQIPL
FIVENGLGAKDQLVQTADGSMTVHDDYRIDYMSQHLVQVAKAIEDGVEVMGYTSWGCIDC
VSMSTAQLSKRYGFIYVDRNDDGTGQLTRYKKKSFDWYRQVIQTNGRYLEDNFS
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgggaatttttccaaaagatttcttatggggcggcgcagtagctgccaaccaagtggaa
ggagcatttgaggcagacgcaaaaggtttgtccgtacaagatgttctaccaaatggtgga
ctaggagaatggacagatagtcctaccagcgataatttaactttagaggcgattgatttt
taccaccgctacaaagaagacattgctctttttgccgagatgggctttaaagtctttcga
acgtctattgcttggtctcgtatttttccaaatggtgacgatgaccagcccaatgaagca
ggtttgcaattttatgatgacttattcgatgaattgttgaactatggcatcgaaccctta
gtgaccttgtcgcattatgagacacctctgcatttggccaaagcctataatggttggaca
gatagacgtctgattggcttttttgagcgctttgctcagacagtcatggaacgctataag
gacaaagtcaaatactggttgacctttaacgaagtcaactcgattttacacatgcccttt
accagtggtggcatcatgacagaaaaagaaaagctgagcctgcaagatttataccaagct
attcatcatgaattggtagcatctgctagtgtcacaaagctagcgcatgaaatcaatcct
gatgttaaagttgggtgtatgattttggcgatgcctgcttacccaatgacctctgatcct
cgtgatatacttgctgcgcatgcatttgaaaatcttaatctcttattttcagatattcat
gtgagaggcaagtatccttcatatattaagtcgtattttaaagaaaatgggattgagatt
gtttttgaagacggagacaaggaattattagcggaacatacggttgattttctatccttt
agctattacatgagtgtcacacaagcccacaatcctgaagcttacacatctggtcaggga
aatattctaggtggtttgtccaatccatatttagaatcttcggagtggggttggcagata
gacccaattggtctgcgattggtcttgaatcagtactatgaccgctaccagattcctttg
tttattgttgaaaatggcttaggtgcaaaggatcagctggtgcaaaccgcagatggcagc
atgacggttcacgatgattatcgcattgactacatgagtcagcatctcgtacaagttgcc
aaagcgattgaagatggcgttgaggtcatgggttacacttcttggggctgtattgattgt
gtctctatgtcaacagcccaattaagtaaacgctacggttttatttatgttgaccgaaat
gatgatggtactggtcaactcacacgctataagaaaaaatcatttgattggtaccgacaa
gtcattcaaaccaatggacgttaccttgaggataatttttcctaa

DBGET integrated database retrieval system