KEGG   Streptococcus pyogenes M1 GAS (serotype M1): SPy_0613Help
Entry
SPy_0613          CDS       T00050                                 

Gene name
tpi
Definition
(RefSeq) putative triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
spy  Streptococcus pyogenes M1 GAS (serotype M1)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:spy00001]
   00010 Glycolysis / Gluconeogenesis
    SPy_0613 (tpi)
   00051 Fructose and mannose metabolism
    SPy_0613 (tpi)
   00562 Inositol phosphate metabolism
    SPy_0613 (tpi)
Enzymes [BR:spy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SPy_0613 (tpi)
Exosome [BR:spy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SPy_0613 (tpi)
  Exosomal proteins of bladder cancer cells
   SPy_0613 (tpi)
  Exosomal proteins of melanoma cells
   SPy_0613 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
493635..494393
Genome map
AA seq 252 aa AA seqDB search
MSRKPIIAGNWKMNKNPQEAKAFVEAVASKLPSTDLVDVAVAAPAVDLVTTIEAAKDSVL
KVAAQNCYFENTGAFTGETSPKVLAEMGADYVVIGHSERRDYFHETDEDINKKAKAIFAN
GLTPIVCCGESLETYEAGKAVEFVGAQVSAALAGLSAEQVASLVLAYEPIWAIGTGKSAT
QDDAQNMCKAVRDVVAADFGQEVADKVRVQYGGSVKPENVKDYMACPDVDGALVGGASLE
ADSFLALLDFLN
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccaattattgctggtaactggaaaatgaacaaaaaccctcaagaagca
aaagcattcgttgaggctgtagcaagcaaattaccttcaactgaccttgttgatgttgcc
gtagcagccccagctgttgatttggtaaccactattgaagctgctaaagattcagttctt
aaagttgctgcacaaaactgctactttgaaaacacaggggcattcactggtgaaacatca
ccaaaagtgcttgctgaaatgggagctgactatgttgtgattggtcactcagaacgccgt
gattacttccatgaaacagatgaagacattaataaaaaagccaaagcaatctttgctaac
ggtttaactccaattgtttgttgtggtgagtctcttgaaacttatgaagctggtaaagcc
gttgagtttgtaggtgcgcaagtttcagcagcacttgcaggtctttcagcagagcaagta
gcttcacttgttttagcttatgagccaatctgggctatcggtactggtaaatcagctact
caagatgatgctcaaaacatgtgtaaagctgttcgtgatgtggtagcagcagactttggg
caagaagttgctgataaagttcgcgttcaatacggtggttctgtaaaacctgaaaacgtt
aaagattacatggcttgtccagatgttgacggtgcccttgtaggtggtgcatcacttgaa
gctgatagcttccttgctttgcttgatttccttaactaa

DBGET integrated database retrieval system