KEGG   Streptococcus pyogenes SF370 (serotype M1): SPy_0763Help
Entry
SPy_0763          CDS       T00050                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
spy  Streptococcus pyogenes SF370 (serotype M1)
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spy00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SPy_0763
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SPy_0763
Enzymes [BR:spy01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     SPy_0763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
621629..622900
Genome map
AA seq 423 aa AA seqDB search
MDKIIIEGGQTRLEGEVVIEGAKNAVLPLLAASILPSKGKTILRNVPILSDVFTMNNVVR
GLDIRVDFNEAANEITVDASGHILDEAPYEYVSQMRASIVVLGPILARNGHAKVSMPGGC
TIGSRPINLHLKGLEAMGATITQKGGDITAQADRLQGAMIYMDFPSVGATQNLMMAATLA
DGVTTIENAAREPEIVDLAQFLNKMGARIRGAGTETLTITGVTHLRGVEHDVVQDRIEAG
TFMVAAAMTSGNVLIRDAVWEHNRPLISKLMEMGVSVTEEEYGIRVQANTPKLKPVTVKT
LPHPGFPTDMQAQFTALMAVVNGESTMVETVFENRFQHLEEMRRMGLQSEILRETAMIHG
GRQLQGAPVMSTDLRASAALILTGIVAQGVTIVNNLVHLDRGYYQFHEKLAKLGATISRS
SEV
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtggataaaataatcattgaaggtggtcaaacacgcttagaaggagaagttgttattgag
ggtgctaaaaacgcagttcttcctttactggcagcatctattttaccttcaaaaggaaaa
acaattcttagaaacgttcctattctatctgatgtttttaccatgaataacgtggtacgt
ggtttagatattcgtgttgattttaatgaagcagctaacgaaatcacagttgatgcctca
ggacacattttagatgaagccccttacgagtacgtgagccaaatgcgtgcctctattgtt
gttttaggaccaattttggcacgtaatggccacgcaaaagtatcaatgcctggaggctgt
acgattggcagtaggcctattaatttgcacttaaaaggattagaggctatgggggcaacg
attactcaaaaaggtggagatattaccgctcaagcagatcgactgcaaggtgccatgatt
tatatggacttcccatctgtaggagctacccaaaacttgatgatggctgccactttagct
gatggtgtgaccactattgaaaatgctgctcgtgagcctgaaattgttgatttagctcaa
tttttgaataaaatgggagctagaattcgtggtgctggaacagagacgttaacgataaca
ggtgtcacgcatttacgaggcgtagaacatgatgttgttcaagatcgtatagaagccggt
acatttatggttgcagcggcgatgacttcaggcaatgttttgattagagatgctgtttgg
gaacataatcgtccattgatttcaaaattaatggaaatgggtgtttctgtaacagaagaa
gaatacggtattcgcgttcaagcaaacacgccaaagctcaaacctgtaacggttaaaacc
ttgcctcatccaggttttccaacagacatgcaagctcaatttacagctttaatggcagtg
gtcaatggagagtctactatggttgaaactgtctttgaaaatcgatttcaacatctggaa
gaaatgcgacgcatgggcttacaatctgaaatccttagggaaactgccatgattcatggt
ggaagacaactgcaaggtgctcctgtgatgtcaacagatttacgtgccagtgctgccctt
atcttgacagggattgttgctcaaggagttacaatagttaataatttggttcatttagat
cgtggctactatcaatttcatgaaaaattagcaaagcttggagctactattagtcgtagc
agtgaggtctag

DBGET integrated database retrieval system