KEGG   Streptococcus pyogenes SF370 (serotype M1): SPy_0883Help
Entry
SPy_0883          CDS       T00050                                 

Gene name
dyr
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
spy  Streptococcus pyogenes SF370 (serotype M1)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SPy_0883 (dyr)
   00670 One carbon pool by folate
    SPy_0883 (dyr)
Enzymes [BR:spy01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     SPy_0883 (dyr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
731160..731657
Genome map
AA seq 165 aa AA seqDB search
MTKEIIAIWAEDEAGLIGIAGKLPWYLPKELEHFKKTTLHQAILMGRVTFEGMNCKRLPQ
RQTLVMTRNRDYQVDEVLTMTSIEKVLEWYHAQDKTLYIIGGNKVLEAFNGYFDRIIKTV
IHHRFKGDTYRPNLDFSHFTQESQTFYARDAKNPYDFTVTALKHK
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaggaaattattgctatttgggcagaggatgaagcagggcttattggtattgcg
ggtaagttaccatggtatttaccaaaagagttagaacattttaaaaagacaacgctacat
caagcaatcttaatgggccgtgtgacttttgaaggaatgaattgcaaaagacttcctcaa
cgtcaaacccttgtcatgacaagaaatagagattatcaagtagatgaggtgttgacaatg
actagtattgaaaaagtcttggagtggtaccatgcgcaggataaaacactttatatcatt
ggtgggaataaggttttagaagcgtttaatggttatttcgatcgtatcataaaaacagtt
atccatcatcgttttaaaggagatacctaccgaccaaatctagattttagtcatttcacg
caagaaagccaaacgttctatgctcgagacgctaaaaatccttatgattttaccgttact
gctttaaaacacaaatag

DBGET integrated database retrieval system