KEGG   Streptococcus pyogenes SF370 (serotype M1): SPy_1035Help
Entry
SPy_1035          CDS       T00050                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
spy  Streptococcus pyogenes SF370 (serotype M1)
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:spy00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:spy00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(845487..846824)
Genome map
AA seq 445 aa AA seqDB search
MKTLLGIIAGKAAQSILTKLGRGSTYPGRLALACDKDILKDLSKDYDIVVVTGTNGKTLT
TALTVGILKEAFGEIITNPSGANMITGITSTFLAAKKGKSERQIAVLEIDEASLPRITTY
LKPSLFVYTNIFRDQMDRYGEIYTTYQMIVDGARNAPKATILANGDSPIFSSKDIVNPVQ
YYGFDTAKHAPQLAHYNTEGILCPKCEHILQYRLNTYANLGDFVCLNCQFQRPTLDYQLT
ELTAITHQSSEFVIDGQNYKINVGGLYNIYNALAAVSVAEFFGVSPEKIKAGFNKSKAVF
GRQETFTVGDKSCTLILIKNPVGASQALEMIQLADYPFSLSVLLNANYADGIDTSWIWDA
NFELITQMPITEINAGGVRHSEIARRLRVTGFDDTKIKQAEKLEQIIETIEKQEAKHAYI
LATYTAMLEFRSLLADRHVVEKEMI
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgaagacattactcggcattattgctggcaaagctgctcaatccattttaacaaaacta
gggcgaggatctacttatcctggtcgattggctctagcttgtgataaagatattttaaag
gatttgtctaaagactatgatattgtggtcgtcactggtactaatggtaaaacgttaaca
actgctcttactgtcggtattttgaaagaggcatttggcgagataatcacaaatccaagt
ggtgccaatatgattactggaattacttctacttttttagctgctaaaaaagggaaatct
gaaaggcaaattgctgttttagaaattgacgaggctagtcttcctagaattaccacttac
ttaaaacctagtctttttgtttatactaatatttttagggatcagatggaccgctacgga
gagatttacactacttatcagatgattgtagatggtgctcgaaatgctccaaaagcaact
attctagccaatggagatagtcctattttctcttctaaggacatagttaatccagttcag
tattatggttttgatactgctaagcatgctccgcagctagctcattacaacacagaaggg
attttatgtccaaaatgcgaacatattcttcagtatcgtctcaatacttatgcgaatcta
ggagactttgtttgcttaaactgtcagttccaaagaccaacgttagattatcaattaact
gagctcaccgctattactcaccaaagttctgaatttgttattgatggacaaaactacaag
ataaatgttggtggtctttataatatttacaatgcgctcgctgccgtctctgttgctgaa
tttttcggtgtttctcccgagaaaatcaaggcgggctttaacaaaagtaaggcggttttt
ggaagacaagaaacttttactgttggtgataaatcatgcacccttatccttatcaagaat
cctgttggagccagtcaggcactggaaatgattcaattggcagattatccatttagctta
tcagttttattaaatgccaattacgctgatggcattgataccagctggatttgggatgct
aattttgaactcattacccaaatgcccattacagaaattaatgctggcggcgtccgccac
tctgaaattgctagaagacttagagtcacaggatttgacgatactaagataaaacaagct
gaaaagctcgagcaaatcatagaaaccattgaaaaacaagaagctaagcatgcctatatt
ttagcaacctatacggcaatgttagaattccgtagcttacttgctgaccgccatgtcgtt
gaaaaggagatgatctaa

DBGET integrated database retrieval system