KEGG   Streptococcus pyogenes SF370 (serotype M1): SPy_1035Help
Entry
SPy_1035          CDS       T00050                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
spy  Streptococcus pyogenes SF370 (serotype M1)
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:spy00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    SPy_1035
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SPy_1035
Enzymes [BR:spy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     SPy_1035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(845487..846824)
Genome map
AA seq 445 aa AA seqDB search
MKTLLGIIAGKAAQSILTKLGRGSTYPGRLALACDKDILKDLSKDYDIVVVTGTNGKTLT
TALTVGILKEAFGEIITNPSGANMITGITSTFLAAKKGKSERQIAVLEIDEASLPRITTY
LKPSLFVYTNIFRDQMDRYGEIYTTYQMIVDGARNAPKATILANGDSPIFSSKDIVNPVQ
YYGFDTAKHAPQLAHYNTEGILCPKCEHILQYRLNTYANLGDFVCLNCQFQRPTLDYQLT
ELTAITHQSSEFVIDGQNYKINVGGLYNIYNALAAVSVAEFFGVSPEKIKAGFNKSKAVF
GRQETFTVGDKSCTLILIKNPVGASQALEMIQLADYPFSLSVLLNANYADGIDTSWIWDA
NFELITQMPITEINAGGVRHSEIARRLRVTGFDDTKIKQAEKLEQIIETIEKQEAKHAYI
LATYTAMLEFRSLLADRHVVEKEMI
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgaagacattactcggcattattgctggcaaagctgctcaatccattttaacaaaacta
gggcgaggatctacttatcctggtcgattggctctagcttgtgataaagatattttaaag
gatttgtctaaagactatgatattgtggtcgtcactggtactaatggtaaaacgttaaca
actgctcttactgtcggtattttgaaagaggcatttggcgagataatcacaaatccaagt
ggtgccaatatgattactggaattacttctacttttttagctgctaaaaaagggaaatct
gaaaggcaaattgctgttttagaaattgacgaggctagtcttcctagaattaccacttac
ttaaaacctagtctttttgtttatactaatatttttagggatcagatggaccgctacgga
gagatttacactacttatcagatgattgtagatggtgctcgaaatgctccaaaagcaact
attctagccaatggagatagtcctattttctcttctaaggacatagttaatccagttcag
tattatggttttgatactgctaagcatgctccgcagctagctcattacaacacagaaggg
attttatgtccaaaatgcgaacatattcttcagtatcgtctcaatacttatgcgaatcta
ggagactttgtttgcttaaactgtcagttccaaagaccaacgttagattatcaattaact
gagctcaccgctattactcaccaaagttctgaatttgttattgatggacaaaactacaag
ataaatgttggtggtctttataatatttacaatgcgctcgctgccgtctctgttgctgaa
tttttcggtgtttctcccgagaaaatcaaggcgggctttaacaaaagtaaggcggttttt
ggaagacaagaaacttttactgttggtgataaatcatgcacccttatccttatcaagaat
cctgttggagccagtcaggcactggaaatgattcaattggcagattatccatttagctta
tcagttttattaaatgccaattacgctgatggcattgataccagctggatttgggatgct
aattttgaactcattacccaaatgcccattacagaaattaatgctggcggcgtccgccac
tctgaaattgctagaagacttagagtcacaggatttgacgatactaagataaaacaagct
gaaaagctcgagcaaatcatagaaaccattgaaaaacaagaagctaagcatgcctatatt
ttagcaacctatacggcaatgttagaattccgtagcttacttgctgaccgccatgtcgtt
gaaaaggagatgatctaa

DBGET integrated database retrieval system